BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_8040_orf1 (153 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|261338083|ref|ZP_05965967.1| lysine--tRNA ligase [Bifidobacte... 36 2.1 gi|262368637|ref|ZP_06061966.1| predicted protein [Acinetobacter... 35 2.4 >gi|261338083|ref|ZP_05965967.1| lysine--tRNA ligase [Bifidobacterium gallicum DSM 20093] gi|270276700|gb|EFA22554.1| lysine--tRNA ligase [Bifidobacterium gallicum DSM 20093] Length = 930 Score = 35.8 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 46 AADIAEFLCITGGETLKWPSFLAGADTYLQPQRGVPVAQRAENGADNLTRSNPCGNTRQ 104 A D+AE L GGE++ + + G D +L P R VA A NG LT + P G+ + Sbjct: 575 ARDLAESLVEQGGESMSFMTTWEGNDYWLSPTRRSAVAYHALNGI-ALTCTGPFGDPEE 632 >gi|262368637|ref|ZP_06061966.1| predicted protein [Acinetobacter johnsonii SH046] gi|262316315|gb|EEY97353.1| predicted protein [Acinetobacter johnsonii SH046] Length = 112 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 15/87 (17%) Query: 18 FFSGSSLCKKHEKQLLDVEGTV------CTEGWLAADIAEFLCITGGETLKW---PSFLA 68 FF+ +S KH+KQ+ E T+ T GWL I+ F+C+T G W S+ Sbjct: 15 FFALASSMSKHQKQIFAKELTLQQTRLATTVGWLLLIISLFICLTQGH---WSTEISYWV 71 Query: 69 GADTYLQPQRGVPVA---QRAENGADN 92 G T+ GV ++ Q+ +N A + Sbjct: 72 GVITFAALFVGVCLSYFEQKIKNIAVS 98 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.314 0.130 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,627,854,788 Number of extensions: 67029794 Number of successful extensions: 103204 Number of sequences better than 10.0: 7 Number of HSP's gapped: 104968 Number of HSP's successfully gapped: 7 Length of query: 153 Length of database: 5,058,227,080 Length adjustment: 116 Effective length of query: 37 Effective length of database: 3,344,010,168 Effective search space: 123728376216 Effective search space used: 123728376216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 76 (33.9 bits)