BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_8008_orf2 (62 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|164415459|gb|ABY53156.1| microneme protein 5 [Eimeria necatrix] 100 7e-20 gi|5708122|emb|CAB52368.1| microneme protein 5 [Eimeria tenella] 100 7e-20 gi|340348492|ref|ZP_08671576.1| aconitate hydratase [Prevotella ... 34 6.4 >gi|164415459|gb|ABY53156.1| microneme protein 5 [Eimeria necatrix] Length = 490 Score = 100 bits (249), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 16 GCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFDQV 62 GCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFDQV Sbjct: 424 GCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFDQV 470 >gi|5708122|emb|CAB52368.1| microneme protein 5 [Eimeria tenella] Length = 932 Score = 100 bits (249), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 16 GCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFDQV 62 GCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFDQV Sbjct: 859 GCARCTRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFDQV 905 >gi|340348492|ref|ZP_08671576.1| aconitate hydratase [Prevotella dentalis DSM 3688] gi|339607061|gb|EGQ12013.1| aconitate hydratase [Prevotella dentalis DSM 3688] Length = 766 Score = 34.3 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 21 TRAAIAFGGKELQTVSGLPHETVCQFACELNKKCKFFTFD 60 T A + + G+ +QT+S T+C EL C F FD Sbjct: 229 TNAILEYFGEGVQTLSATGRATICNMGAELGATCSLFPFD 268 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.328 0.139 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 441,129,579 Number of extensions: 10331660 Number of successful extensions: 24141 Number of sequences better than 10.0: 3 Number of HSP's gapped: 24229 Number of HSP's successfully gapped: 3 Length of query: 62 Length of database: 5,058,227,080 Length adjustment: 34 Effective length of query: 28 Effective length of database: 4,555,784,192 Effective search space: 127561957376 Effective search space used: 127561957376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.9 bits)