BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_8005_orf1 (123 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325115170|emb|CBZ50726.1| putative ribosome biogenesis protei... 36 2.2 gi|237844727|ref|XP_002371661.1| ribosome biogenesis protein BOP... 34 6.6 gi|221501810|gb|EEE27566.1| WD domain, G-beta repeat containing ... 34 6.8 >gi|325115170|emb|CBZ50726.1| putative ribosome biogenesis protein BOP1 [Neospora caninum Liverpool] Length = 1343 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 26/64 (40%), Positives = 32/64 (50%) Query: 22 SSDGCLRVFEVKTGRIAAAVLLQQQITAAAFHPRXXXXXXXXXXXXXXFVLDQPAFDDSS 81 +D L V EV TG+ + LQ Q+TA AFHPR VLD P FD S Sbjct: 895 GADNTLHVLEVLTGKRFLSFRLQAQVTALAFHPRLPILAAAIEDQLLLTVLDLPLFDQKS 954 Query: 82 LQQL 85 ++QL Sbjct: 955 VEQL 958 >gi|237844727|ref|XP_002371661.1| ribosome biogenesis protein BOP1, putative [Toxoplasma gondii ME49] gi|211969325|gb|EEB04521.1| ribosome biogenesis protein BOP1, putative [Toxoplasma gondii ME49] gi|221480934|gb|EEE19351.1| WD domain, G-beta repeat containing protein, putative [Toxoplasma gondii GT1] Length = 1035 Score = 34.3 bits (77), Expect = 6.6, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 22/33 (66%) Query: 23 SDGCLRVFEVKTGRIAAAVLLQQQITAAAFHPR 55 +D LRV E+ TG+ + LQQ +TA AFHPR Sbjct: 585 ADQTLRVVELLTGKQFLSFRLQQPVTALAFHPR 617 >gi|221501810|gb|EEE27566.1| WD domain, G-beta repeat containing protein, putative [Toxoplasma gondii VEG] Length = 1032 Score = 34.3 bits (77), Expect = 6.8, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 22/34 (64%) Query: 22 SSDGCLRVFEVKTGRIAAAVLLQQQITAAAFHPR 55 +D LRV E+ TG+ + LQQ +TA AFHPR Sbjct: 581 GADQTLRVVELLTGKQFLSFRLQQPVTALAFHPR 614 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.323 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 409,619,086 Number of extensions: 7193446 Number of successful extensions: 13356 Number of sequences better than 10.0: 3 Number of HSP's gapped: 13369 Number of HSP's successfully gapped: 3 Length of query: 123 Length of database: 5,058,227,080 Length adjustment: 89 Effective length of query: 34 Effective length of database: 3,743,008,932 Effective search space: 127262303688 Effective search space used: 127262303688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 76 (33.9 bits)