BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_7686_orf1 (193 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325120414|emb|CBZ55968.1| unnamed protein product [Neospora c... 47 0.001 gi|237835685|ref|XP_002367140.1| hypothetical protein TGME49_047... 45 0.005 gi|221485325|gb|EEE23606.1| conserved hypothetical protein [Toxo... 45 0.006 >gi|325120414|emb|CBZ55968.1| unnamed protein product [Neospora caninum Liverpool] Length = 1452 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 31/90 (34%), Positives = 37/90 (41%) Query: 104 LQLLKNVVLICLADLRDCCIPAVYVHLGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF 163 L L KN +LICL DLRD C+ + + F Sbjct: 1299 LSLTKNAILICLTDLRDACLALCFSTVAEQEERRRMVQQHIFHVQDACRREMVLPYLHLF 1358 Query: 164 EVSLAANLLPHNLSAVCQRLLFSALDMLAR 193 E L N LPH + QR+LFSALDM AR Sbjct: 1359 ECLLLLNQLPHEVEVAAQRILFSALDMHAR 1388 >gi|237835685|ref|XP_002367140.1| hypothetical protein TGME49_047730 [Toxoplasma gondii ME49] gi|211964804|gb|EEA99999.1| hypothetical protein TGME49_047730 [Toxoplasma gondii ME49] gi|221506185|gb|EEE31820.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 1502 Score = 45.1 bits (105), Expect = 0.005, Method: Compositional matrix adjust. Identities = 30/90 (33%), Positives = 36/90 (40%) Query: 104 LQLLKNVVLICLADLRDCCIPAVYVHLGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF 163 L L KN + ICL DLRD C+ + + F Sbjct: 1353 LALTKNAISICLTDLRDACLALCFSTVAEQEERRRMVQQHIFHVQDAGRKEMILPYLHLF 1412 Query: 164 EVSLAANLLPHNLSAVCQRLLFSALDMLAR 193 E L N LPH + QR+LFSALDM AR Sbjct: 1413 ECLLLLNQLPHEIEVPAQRILFSALDMHAR 1442 >gi|221485325|gb|EEE23606.1| conserved hypothetical protein [Toxoplasma gondii GT1] Length = 1502 Score = 45.1 bits (105), Expect = 0.006, Method: Compositional matrix adjust. Identities = 30/90 (33%), Positives = 36/90 (40%) Query: 104 LQLLKNVVLICLADLRDCCIPAVYVHLGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF 163 L L KN + ICL DLRD C+ + + F Sbjct: 1353 LALTKNAISICLTDLRDACLALCFSTVAEQEERRRMVQQHIFHVQDAGRKEMILPYLHLF 1412 Query: 164 EVSLAANLLPHNLSAVCQRLLFSALDMLAR 193 E L N LPH + QR+LFSALDM AR Sbjct: 1413 ECLLLLNQLPHEIEVPAQRILFSALDMHAR 1442 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.324 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 943,477,713 Number of extensions: 18883220 Number of successful extensions: 19543 Number of sequences better than 10.0: 3 Number of HSP's gapped: 19544 Number of HSP's successfully gapped: 3 Length of query: 193 Length of database: 5,058,227,080 Length adjustment: 132 Effective length of query: 61 Effective length of database: 3,107,566,456 Effective search space: 189561553816 Effective search space used: 189561553816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 77 (34.3 bits)