BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_7659_orf3 (193 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|302908286|ref|XP_003049834.1| predicted protein [Nectria haem... 37 1.3 gi|297569325|ref|YP_003690669.1| ATP phosphoribosyltransferase [... 35 3.7 >gi|302908286|ref|XP_003049834.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256730770|gb|EEU44121.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 546 Score = 37.0 bits (84), Expect = 1.3, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Query: 70 DRHAGRPEGLAGSKTSAETALLVSFLHRHALTWGGAAATPQENLRQAPAGAIRRVSSASM 129 D H+ P + + + E LL FLH L GG P E+ +Q+PA A RR S + M Sbjct: 218 DMHSFHPNYMIAPEVTHEFNLLNDFLHTSLLDDGG---VPSEDSQQSPA-AFRRSSQSEM 273 Query: 130 LRAVG 134 L G Sbjct: 274 LPGFG 278 >gi|297569325|ref|YP_003690669.1| ATP phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2] gi|296925240|gb|ADH86050.1| ATP phosphoribosyltransferase [Desulfurivibrio alkaliphilus AHT2] Length = 290 Score = 35.4 bits (80), Expect = 3.7, Method: Compositional matrix adjust. Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 18/88 (20%) Query: 60 PSNWLDTVPSDRHAGRPEGLAGSKTSAETALLVSFLHRH----------ALTWGGAAATP 109 P+ W+ VP D RPE L G K + E LV+F + A +WG A Sbjct: 95 PTRWVLAVPGDSPVKRPEDLEGKKIATE---LVNFTKEYFASRNINVDIAFSWGATEAKV 151 Query: 110 QENLRQAPAGAIRRVS-SASMLRAVGLQ 136 L A AI V+ + S +RA GL+ Sbjct: 152 VSGL----ADAIVEVTETESTIRAHGLR 175 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.319 0.133 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,520,776,754 Number of extensions: 50114893 Number of successful extensions: 94747 Number of sequences better than 10.0: 5 Number of HSP's gapped: 95305 Number of HSP's successfully gapped: 5 Length of query: 193 Length of database: 5,058,227,080 Length adjustment: 132 Effective length of query: 61 Effective length of database: 3,107,566,456 Effective search space: 189561553816 Effective search space used: 189561553816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 77 (34.3 bits)