BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_7659_orf1 (194 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|229591292|ref|YP_002873411.1| hypothetical protein PFLU3857 [... 38 0.60 gi|171058246|ref|YP_001790595.1| metallophosphoesterase [Leptoth... 37 2.1 gi|118575855|ref|YP_875598.1| hypothetical protein CENSYa_0661 [... 35 4.1 >gi|229591292|ref|YP_002873411.1| hypothetical protein PFLU3857 [Pseudomonas fluorescens SBW25] gi|229363158|emb|CAY50200.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25] Length = 300 Score = 38.1 bits (87), Expect = 0.60, Method: Compositional matrix adjust. Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 11/110 (10%) Query: 29 VSRFLRAGRTLE--AALSSAKRQLGQLRPR-RCCSPTARSMEADETR-RIAPAGACLRFS 84 + ++L +G L +L+SA+R ++ P SP ADE R+AP G R Sbjct: 188 LEQWLNSGHGLAFPESLASARRDRSEVAPTGLLLSPVRLQHLADEIESRLAPHGTWRRRL 247 Query: 85 CGVAAAPPH--VRACLCKNDTRRAVS----AEVLEPAKPSGRPAWRSEGT 128 C A A P VR L KN R+ + A + +P KP+ P W +E T Sbjct: 248 CDWAIAHPQSGVRRLL-KNRVRKLLGFQRLAYIWQPLKPTAEPTWLAEFT 296 >gi|171058246|ref|YP_001790595.1| metallophosphoesterase [Leptothrix cholodnii SP-6] gi|170775691|gb|ACB33830.1| metallophosphoesterase [Leptothrix cholodnii SP-6] Length = 430 Score = 36.6 bits (83), Expect = 2.1, Method: Compositional matrix adjust. Identities = 33/135 (24%), Positives = 53/135 (39%), Gaps = 13/135 (9%) Query: 16 CWRNVVSLRLSPQVSRFLRAGRTLEAALSSAKR------QLGQLR----PRRCCSPTARS 65 + N+V ++ QV + AG + Q+G+L+ P Sbjct: 47 AFDNLVGEAIAEQVDFMVIAGDLYDGGWKDFNTGIFFVAQMGRLKAAGIPVYLLLGN-HD 105 Query: 66 MEADETRRIAPAGACLRFSCGVAAA--PPHVRACLCKNDTRRAVSAEVLEPAKPSGRPAW 123 E++ T+R+A RF G AA P +R L + A + E L P P W Sbjct: 106 AESEMTKRLALPDNVHRFPVGKAATFRLPELRVALHGRSFKEAATTENLALTYPDPVPGW 165 Query: 124 RSEGTVSSQLEGTSS 138 + G + + LEG S+ Sbjct: 166 LNIGVLHTALEGNSA 180 >gi|118575855|ref|YP_875598.1| hypothetical protein CENSYa_0661 [Cenarchaeum symbiosum A] gi|118194376|gb|ABK77294.1| hypothetical protein CENSYa_0661 [Cenarchaeum symbiosum A] Length = 132 Score = 35.4 bits (80), Expect = 4.1, Method: Compositional matrix adjust. Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 10/65 (15%) Query: 1 STVSPRTRTVSNCLFCWRNVVSLRLSPQVSRFLR----------AGRTLEAALSSAKRQL 50 S ++PR T+S+C+F + +R SP S F AGR++ + S Q+ Sbjct: 46 SALAPRVSTISSCIFFVKYCSDMRASPLASSFTEVSTYSLTLPSAGRSMFFSAQSPSLQI 105 Query: 51 GQLRP 55 G+LRP Sbjct: 106 GRLRP 110 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.321 0.128 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,358,226,768 Number of extensions: 44066680 Number of successful extensions: 115295 Number of sequences better than 10.0: 24 Number of HSP's gapped: 116435 Number of HSP's successfully gapped: 24 Length of query: 194 Length of database: 5,058,227,080 Length adjustment: 132 Effective length of query: 62 Effective length of database: 3,107,566,456 Effective search space: 192669120272 Effective search space used: 192669120272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 77 (34.3 bits)