BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_7516_orf3
         (86 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|293376714|ref|ZP_06622937.1| putative ferredoxin hydrogenase ...    34     9.1  

>gi|293376714|ref|ZP_06622937.1| putative ferredoxin hydrogenase [Turicibacter sanguinis PC909]
 gi|325845179|ref|ZP_08168487.1| ferredoxin hydrogenase [Turicibacter sp. HGF1]
 gi|292644671|gb|EFF62758.1| putative ferredoxin hydrogenase [Turicibacter sanguinis PC909]
 gi|325488775|gb|EGC91176.1| ferredoxin hydrogenase [Turicibacter sp. HGF1]
          Length = 590

 Score = 33.9 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 35  KCSSCSRRPVGARKTLSCDSSPTA---EGLRFTTIYLRDSHSDIRSTNESSFCGR 86
           +C++C R      K LS D   T    +G R  TIY  DS+S +R T++   CGR
Sbjct: 99  ECTTCVRNHNCELKQLSNDLGCTGRHFKGERRETIYRDDSYSIVRDTSKCILCGR 153


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.314    0.126    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 808,986,300
Number of extensions: 26276771
Number of successful extensions: 41680
Number of sequences better than 10.0: 1
Number of HSP's gapped: 42058
Number of HSP's successfully gapped: 1
Length of query: 86
Length of database: 5,058,227,080
Length adjustment: 56
Effective length of query: 30
Effective length of database: 4,230,674,088
Effective search space: 126920222640
Effective search space used: 126920222640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 76 (33.9 bits)