BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_7516_orf1 (86 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325119093|emb|CBZ54645.1| conserved hypothetical protein [Neo... 47 9e-04 gi|221483325|gb|EEE21644.1| conserved hypothetical protein [Toxo... 42 0.027 gi|237839471|ref|XP_002369033.1| hypothetical protein TGME49_036... 42 0.028 gi|221507811|gb|EEE33398.1| conserved hypothetical protein [Toxo... 42 0.038 >gi|325119093|emb|CBZ54645.1| conserved hypothetical protein [Neospora caninum Liverpool] Length = 465 Score = 47.0 bits (110), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 37/71 (52%) Query: 2 PQKLDSLVDLISECESLKYIVVKRRPSAVGEESQDSVFLAPTGRLLQELHLGRFRRECKE 61 P +L++L D + EC LKY+ S+ S + PT RL EL L FR+ECK Sbjct: 368 PLRLETLWDFLLECRLLKYLTFVSGASSDAPNSHQLSSVRPTSRLRDELSLENFRKECKA 427 Query: 62 AFGLQPPDSRL 72 +G++ P L Sbjct: 428 HWGVRLPSGDL 438 >gi|221483325|gb|EEE21644.1| conserved hypothetical protein [Toxoplasma gondii GT1] Length = 477 Score = 42.0 bits (97), Expect = 0.027, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Query: 2 PQKLDSLVDLISECESLKYIVVKRRPSAVGEESQDSVFLAPTGRLLQELHLGRFRRECKE 61 P +L++L D + EC LKY+ S+ Q S + PT RL EL L FR+EC+ Sbjct: 380 PPRLETLWDFLLECRLLKYLSFASGASSDSNSQQLSC-VRPTSRLRDELSLDNFRKECRA 438 Query: 62 AFGLQPPDSRL 72 + ++ P L Sbjct: 439 HWSVRLPSGDL 449 >gi|237839471|ref|XP_002369033.1| hypothetical protein TGME49_036800 [Toxoplasma gondii ME49] gi|211966697|gb|EEB01893.1| hypothetical protein TGME49_036800 [Toxoplasma gondii ME49] Length = 475 Score = 42.0 bits (97), Expect = 0.028, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Query: 2 PQKLDSLVDLISECESLKYIVVKRRPSAVGEESQDSVFLAPTGRLLQELHLGRFRRECKE 61 P +L++L D + EC LKY+ S+ SQ + PT RL EL L FR+EC+ Sbjct: 379 PPRLETLWDFLLECRLLKYLSFASGASS-DSNSQQLSCVRPTSRLRDELSLDNFRKECRA 437 Query: 62 AFGLQPPDSRL 72 + ++ P L Sbjct: 438 HWSVRLPSGDL 448 >gi|221507811|gb|EEE33398.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 476 Score = 41.6 bits (96), Expect = 0.038, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Query: 2 PQKLDSLVDLISECESLKYIVVKRRPSAVGEESQDSVFLAPTGRLLQELHLGRFRRECKE 61 P +L++L D + EC LKY+ S+ SQ + PT RL EL L FR+EC+ Sbjct: 380 PPRLETLWDFLLECRLLKYLSFASGASS-DSNSQQLSCVRPTSRLRDELSLENFRKECRA 438 Query: 62 AFGLQPPDSRL 72 + ++ P L Sbjct: 439 HWSVRLPSGDL 449 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.319 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 861,534,887 Number of extensions: 30207348 Number of successful extensions: 55138 Number of sequences better than 10.0: 4 Number of HSP's gapped: 55451 Number of HSP's successfully gapped: 4 Length of query: 86 Length of database: 5,058,227,080 Length adjustment: 56 Effective length of query: 30 Effective length of database: 4,230,674,088 Effective search space: 126920222640 Effective search space used: 126920222640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.9 bits)