BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_7219_orf6 (96 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|115638669|ref|XP_791607.2| PREDICTED: hypothetical protein [S... 37 0.88 >gi|115638669|ref|XP_791607.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] gi|115940036|ref|XP_001187739.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus] Length = 388 Score = 37.0 bits (84), Expect = 0.88, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 22/36 (61%) Query: 20 CWCTLLRSQCSYFIAAATPPQQQLGFSGSSRATATP 55 CWC+ + CS+FI +PP +G+ SR+ A+P Sbjct: 250 CWCSQGTNYCSFFIEVESPPGTTIGYIRQSRSFASP 285 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.323 0.134 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 738,241,221 Number of extensions: 21345104 Number of successful extensions: 44474 Number of sequences better than 10.0: 1 Number of HSP's gapped: 44643 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 5,058,227,080 Length adjustment: 65 Effective length of query: 31 Effective length of database: 4,097,674,500 Effective search space: 127027909500 Effective search space used: 127027909500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 76 (33.9 bits)