BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_7219_orf6
         (96 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|115638669|ref|XP_791607.2| PREDICTED: hypothetical protein [S...    37     0.88 

>gi|115638669|ref|XP_791607.2| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115940036|ref|XP_001187739.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 388

 Score = 37.0 bits (84), Expect = 0.88,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 20  CWCTLLRSQCSYFIAAATPPQQQLGFSGSSRATATP 55
           CWC+   + CS+FI   +PP   +G+   SR+ A+P
Sbjct: 250 CWCSQGTNYCSFFIEVESPPGTTIGYIRQSRSFASP 285


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.323    0.134    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 738,241,221
Number of extensions: 21345104
Number of successful extensions: 44474
Number of sequences better than 10.0: 1
Number of HSP's gapped: 44643
Number of HSP's successfully gapped: 1
Length of query: 96
Length of database: 5,058,227,080
Length adjustment: 65
Effective length of query: 31
Effective length of database: 4,097,674,500
Effective search space: 127027909500
Effective search space used: 127027909500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 76 (33.9 bits)