BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_6931_orf4 (57 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|37699770|emb|CAE52295.1| surface antigen 12 [Eimeria tenella] 71 5e-11 gi|37699780|emb|CAE52300.1| surface antigen 9 [Eimeria tenella] 59 2e-07 gi|37699776|emb|CAE52298.1| surface antigen 8 [Eimeria tenella] 55 2e-06 gi|166034393|gb|ABY78897.1| surface antigen 10 [Eimeria tenella] 55 5e-06 gi|37699806|emb|CAE52313.1| surface antigen 10 [Eimeria tenella] 55 5e-06 gi|149980826|gb|ABR53732.1| surface antigen 10 [Eimeria tenella] 54 5e-06 gi|37699778|emb|CAE52299.1| surface antigen 11 [Eimeria tenella] 52 3e-05 gi|37699766|emb|CAE52293.1| surface antigen 5 [Eimeria tenella] 45 0.004 gi|149389603|gb|ABR26258.1| merozoite surface antigen 5 [Eimeria... 45 0.004 gi|37699774|emb|CAE52297.1| surface antigen 6 [Eimeria tenella] 40 0.075 >gi|37699770|emb|CAE52295.1| surface antigen 12 [Eimeria tenella] Length = 260 Score = 71.2 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 35/35 (100%), Positives = 35/35 (100%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL Sbjct: 226 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 260 >gi|37699780|emb|CAE52300.1| surface antigen 9 [Eimeria tenella] Length = 259 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 27/35 (77%), Positives = 29/35 (82%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 QEQWDKIVSSLTGS S+AAP L+ IV FGITAL Sbjct: 225 QEQWDKIVSSLTGSGSVAAPRLIALAIVTFGITAL 259 >gi|37699776|emb|CAE52298.1| surface antigen 8 [Eimeria tenella] Length = 265 Score = 55.5 bits (132), Expect = 2e-06, Method: Composition-based stats. Identities = 29/56 (51%), Positives = 32/56 (57%) Query: 2 YRLNCCEFDGIICVRLNAFRRQEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 Y L C + +A QEQWD+IVSSLTGS S A PS V IV FGIT L Sbjct: 209 YALICKTMPAVFGSDGSALFTQEQWDRIVSSLTGSASTAVPSFVALAIVIFGITTL 264 >gi|166034393|gb|ABY78897.1| surface antigen 10 [Eimeria tenella] Length = 261 Score = 54.7 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 25/35 (71%), Positives = 27/35 (77%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 Q QWDKI+SSLTGS SIAAPSL+ IV FGI L Sbjct: 227 QAQWDKIMSSLTGSGSIAAPSLIALAIVTFGIMTL 261 >gi|37699806|emb|CAE52313.1| surface antigen 10 [Eimeria tenella] Length = 261 Score = 54.7 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 25/35 (71%), Positives = 27/35 (77%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 Q QWDKI+SSLTGS SIAAPSL+ IV FGI L Sbjct: 227 QAQWDKIMSSLTGSGSIAAPSLIALAIVTFGIMTL 261 >gi|149980826|gb|ABR53732.1| surface antigen 10 [Eimeria tenella] Length = 261 Score = 54.3 bits (129), Expect = 5e-06, Method: Composition-based stats. Identities = 25/35 (71%), Positives = 27/35 (77%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 Q QWDKI+SSLTGS SIAAPSL+ IV FGI L Sbjct: 227 QAQWDKIMSSLTGSGSIAAPSLIALAIVTFGIMTL 261 >gi|37699778|emb|CAE52299.1| surface antigen 11 [Eimeria tenella] Length = 263 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 24/35 (68%), Positives = 27/35 (77%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 +EQWDKI SLTGS SIAAPSLV I+A GIT + Sbjct: 229 EEQWDKIKYSLTGSASIAAPSLVALAILALGITTV 263 >gi|37699766|emb|CAE52293.1| surface antigen 5 [Eimeria tenella] Length = 257 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 20/35 (57%), Positives = 26/35 (74%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 Q+QWD+I+SSLTGS S+A P VF + F +TAL Sbjct: 223 QDQWDRIISSLTGSASVAIPGFGVFLLAVFSLTAL 257 >gi|149389603|gb|ABR26258.1| merozoite surface antigen 5 [Eimeria tenella] Length = 257 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 20/35 (57%), Positives = 26/35 (74%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 Q+QWD+I+SSLTGS S+A P VF + F +TAL Sbjct: 223 QDQWDRIISSLTGSASVAIPGFGVFLLAVFSLTAL 257 >gi|37699774|emb|CAE52297.1| surface antigen 6 [Eimeria tenella] Length = 256 Score = 40.4 bits (93), Expect = 0.075, Method: Composition-based stats. Identities = 18/35 (51%), Positives = 22/35 (62%) Query: 23 QEQWDKIVSSLTGSTSIAAPSLVVFGIVAFGITAL 57 Q+QWD+I+SSLTGS S A P F IV + L Sbjct: 222 QDQWDRIISSLTGSASAAIPGFGAFFIVVLSMAVL 256 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.329 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 496,042,102 Number of extensions: 12736097 Number of successful extensions: 41018 Number of sequences better than 10.0: 10 Number of HSP's gapped: 41107 Number of HSP's successfully gapped: 10 Length of query: 57 Length of database: 5,058,227,080 Length adjustment: 30 Effective length of query: 27 Effective length of database: 4,614,895,120 Effective search space: 124602168240 Effective search space used: 124602168240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.9 bits)