BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_6634_orf3
         (105 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|118490718|ref|XP_001238668.1| hypothetical protein, conserved...   101     3e-20

>gi|118490718|ref|XP_001238668.1| hypothetical protein, conserved [Eimeria tenella]
 gi|109238451|emb|CAK51415.1| hypothetical protein, conserved [Eimeria tenella]
          Length = 1321

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 48/59 (81%)

Query: 47  MALYPGAATATRGRPCVGAXXXXXXXXXXXNFCCPCPQRQSLLRFAALCVVCILCFCRS 105
           MALYPGAATATRGRPCVGA           NFCCPCPQRQSLLRFAALCVVCILCFCRS
Sbjct: 1   MALYPGAATATRGRPCVGARRQQQQREQRQNFCCPCPQRQSLLRFAALCVVCILCFCRS 59


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.330    0.138    0.481 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 729,680,556
Number of extensions: 15050805
Number of successful extensions: 23426
Number of sequences better than 10.0: 1
Number of HSP's gapped: 23446
Number of HSP's successfully gapped: 1
Length of query: 105
Length of database: 5,058,227,080
Length adjustment: 73
Effective length of query: 32
Effective length of database: 3,979,452,644
Effective search space: 127342484608
Effective search space used: 127342484608
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 76 (33.9 bits)