BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_6532_orf1 (124 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|47224880|emb|CAG06450.1| unnamed protein product [Tetraodon n... 37 1.2 gi|260799242|ref|XP_002594606.1| hypothetical protein BRAFLDRAFT... 34 7.4 gi|169234675|ref|NP_001108459.1| dopamine receptor-1 [Bombyx mor... 33 9.5 >gi|47224880|emb|CAG06450.1| unnamed protein product [Tetraodon nigroviridis] Length = 777 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Query: 61 WSGNCSRRLGRTT-DSPSYLAAAFSGILPVRLRIKRPDDQQ 100 WSG+ R LGR T DSPS +AAAF+G L + + P++++ Sbjct: 214 WSGSMPRCLGRNTYDSPSDVAAAFTGSLAGLMDVLSPEEKK 254 >gi|260799242|ref|XP_002594606.1| hypothetical protein BRAFLDRAFT_217686 [Branchiostoma floridae] gi|229279841|gb|EEN50617.1| hypothetical protein BRAFLDRAFT_217686 [Branchiostoma floridae] Length = 457 Score = 33.9 bits (76), Expect = 7.4, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Query: 64 NCSRRLGRTTDSPSYLAAAFSGILPVRLRIKRPDDQQVLLLLDHPPTKSTTCRMAL 119 N R T D P+++ F +LP L IKRP D++V+ K T R +L Sbjct: 294 NVHHRTASTHDMPTWIRIVFINVLPRILCIKRPADEEVV------DVKETVIRTSL 343 >gi|169234675|ref|NP_001108459.1| dopamine receptor-1 [Bombyx mori] gi|164690730|dbj|BAF98647.1| dopamine receptor-1 [Bombyx mori] gi|170321830|dbj|BAG14260.1| dopamine receptor 1 [Bombyx mori] Length = 408 Score = 33.5 bits (75), Expect = 9.5, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query: 66 SRRLGRTTDSPSYLAAAFSGILPVRLRIKRPDDQQVLLLLDHPPTKSTTCRMALN 120 +RR+ TT + +L AA LP+ L + RPD++ L P K TC + L Sbjct: 148 TRRVAITTIAMIWLLAALVSFLPISLGLHRPDEEA---LATQRPPKYPTCALVLT 199 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.320 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,121,866,504 Number of extensions: 37931670 Number of successful extensions: 70159 Number of sequences better than 10.0: 6 Number of HSP's gapped: 70594 Number of HSP's successfully gapped: 6 Length of query: 124 Length of database: 5,058,227,080 Length adjustment: 90 Effective length of query: 34 Effective length of database: 3,728,231,200 Effective search space: 126759860800 Effective search space used: 126759860800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 76 (33.9 bits)