BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_6255_orf2 (126 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|282860145|ref|ZP_06269220.1| hypothetical protein HMPREF0648_... 36 1.7 gi|255729628|ref|XP_002549739.1| conserved hypothetical protein ... 34 7.5 gi|254424628|ref|ZP_05038346.1| nickel import ATP-binding protei... 34 7.5 >gi|282860145|ref|ZP_06269220.1| hypothetical protein HMPREF0648_0732 [Prevotella bivia JCVIHMP010] gi|282587034|gb|EFB92264.1| hypothetical protein HMPREF0648_0732 [Prevotella bivia JCVIHMP010] Length = 367 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Query: 37 GVIVRPDNRNRHIMTLSSFKAPTTSPEGPPARRRNLRSGEHSDLVTARTLSQTETEKGQI 96 G+++ PD N+ +S F AP S G N SG ++ + TEKG + Sbjct: 241 GIVIFPDGMNKS-TAMSLFTAPNGSTFGKHTLDTNGPSGNKGKILKMEAV----TEKGCL 295 Query: 97 ERPFAGLKANHGKGE 111 PFAG KG+ Sbjct: 296 FLPFAGWNTGFNKGK 310 >gi|255729628|ref|XP_002549739.1| conserved hypothetical protein [Candida tropicalis MYA-3404] gi|240132808|gb|EER32365.1| conserved hypothetical protein [Candida tropicalis MYA-3404] Length = 3808 Score = 33.9 bits (76), Expect = 7.5, Method: Compositional matrix adjust. Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 9/93 (9%) Query: 10 PYSDHDDLTRRSNGPLQDILEEPEHPPGVIVRPDNRNRHIMTLSSFKAPTTSPEGPPARR 69 P +HD+L +++ L+DI EE GV+ P + ++ ++ +S T Sbjct: 2463 PLDEHDNLQMKASRSLKDITEE----HGVVAIPHDEHQDLIAKAS---KTLDDHAKEQGV 2515 Query: 70 RNLRSGEHSDLVT--ARTLSQTETEKGQIERPF 100 + + +GE+ DLV+ +RT + E+G+I P Sbjct: 2516 KIVATGEYDDLVSKASRTADKLAEEEGKIAIPL 2548 >gi|254424628|ref|ZP_05038346.1| nickel import ATP-binding protein NikD, putative [Synechococcus sp. PCC 7335] gi|196192117|gb|EDX87081.1| nickel import ATP-binding protein NikD, putative [Synechococcus sp. PCC 7335] Length = 638 Score = 33.9 bits (76), Expect = 7.5, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Query: 22 NGPLQDILEEPEHP--PGVIV---RPDNRNRHIMTLSSFKAPTTSPEG 64 G + DI + P+HP G++ RPD R R + T+S + SPEG Sbjct: 275 TGAVLDIFKSPQHPYTQGLLACRPRPDQRLRQLPTVSDYMEEVVSPEG 322 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.309 0.129 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,383,581,275 Number of extensions: 56628765 Number of successful extensions: 103670 Number of sequences better than 10.0: 28 Number of HSP's gapped: 105656 Number of HSP's successfully gapped: 28 Length of query: 126 Length of database: 5,058,227,080 Length adjustment: 92 Effective length of query: 34 Effective length of database: 3,698,675,736 Effective search space: 125754975024 Effective search space used: 125754975024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 76 (33.9 bits)