BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_6147_orf2 (56 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|221508648|gb|EEE34217.1| 14-3-3 protein, putative [Toxoplasma... 39 0.22 gi|221488131|gb|EEE26345.1| 14-3-3 protein, putative [Toxoplasma... 39 0.22 gi|237832753|ref|XP_002365674.1| 14-3-3 protein, putative [Toxop... 39 0.23 gi|119486845|ref|ZP_01620820.1| methyl-accepting chemotaxis prot... 33 9.4 >gi|221508648|gb|EEE34217.1| 14-3-3 protein, putative [Toxoplasma gondii VEG] Length = 452 Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 3/56 (5%) Query: 3 TDIEDQVPLS-LKMGLVLNYAVLLHDEPDGAE--QAINALAAQFREAVENVVHISD 55 T+ +D++ ++ L +G+VLNY VLL G + +AI +AA FR +VEN+ H+ + Sbjct: 365 TEQDDELKVTPLHLGIVLNYGVLLKSINQGQQTNRAIELIAAAFRYSVENMYHVRN 420 >gi|221488131|gb|EEE26345.1| 14-3-3 protein, putative [Toxoplasma gondii GT1] Length = 452 Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 3/56 (5%) Query: 3 TDIEDQVPLS-LKMGLVLNYAVLLHDEPDGAE--QAINALAAQFREAVENVVHISD 55 T+ +D++ ++ L +G+VLNY VLL G + +AI +AA FR +VEN+ H+ + Sbjct: 365 TEQDDELKVTPLHLGIVLNYGVLLKSINQGQQTNRAIELIAAAFRYSVENMYHVRN 420 >gi|237832753|ref|XP_002365674.1| 14-3-3 protein, putative [Toxoplasma gondii ME49] gi|211963338|gb|EEA98533.1| 14-3-3 protein, putative [Toxoplasma gondii ME49] Length = 452 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 3/56 (5%) Query: 3 TDIEDQVPLS-LKMGLVLNYAVLLHDEPDGAE--QAINALAAQFREAVENVVHISD 55 T+ +D++ ++ L +G+VLNY VLL G + +AI +AA FR +VEN+ H+ + Sbjct: 365 TEQDDELKVTPLHLGIVLNYGVLLKSINQGQQTNRAIELIAAAFRYSVENMYHVRN 420 >gi|119486845|ref|ZP_01620820.1| methyl-accepting chemotaxis protein [Lyngbya sp. PCC 8106] gi|119456138|gb|EAW37271.1| methyl-accepting chemotaxis protein [Lyngbya sp. PCC 8106] Length = 1291 Score = 33.5 bits (75), Expect = 9.4, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Query: 1 SQTDIEDQVPLSLKMGLVLNYAVLLHDEPDGAEQA--INALAAQFREAV 47 S++DI L +++GL L+ A LL + D AEQA +N ++++ RE++ Sbjct: 554 SESDINFTKQLGIQVGLALDQASLLQKQQDAAEQARRLNIISSRIRESL 602 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.313 0.130 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 486,484,637 Number of extensions: 12410341 Number of successful extensions: 29778 Number of sequences better than 10.0: 4 Number of HSP's gapped: 29873 Number of HSP's successfully gapped: 4 Length of query: 56 Length of database: 5,058,227,080 Length adjustment: 29 Effective length of query: 27 Effective length of database: 4,629,672,852 Effective search space: 125001167004 Effective search space used: 125001167004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 76 (33.9 bits)