BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_5922_orf1 (99 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|11467092|ref|NP_042567.1| cytochrome oxidase subunit 1 [Chlam... 35 2.9 gi|86553034|gb|ABC98214.1| cytochrome oxidase subunit 1 [Chlamyd... 35 3.1 gi|294845827|gb|ADF43068.1| cytochrome oxidase subunit I [Cognet... 35 3.6 gi|12514|emb|CAA47114.1| cytochrome-c oxidase [Chlamydomonas rei... 34 7.1 gi|124262536|gb|ABM97463.1| cytochrome oxidase subunit I [Sepedo... 34 7.5 gi|124262532|gb|ABM97461.1| cytochrome oxidase subunit I [Sepedo... 34 7.7 >gi|11467092|ref|NP_042567.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|116972|sp|P08681.1|COX1_CHLRE RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|12505|emb|CAA38642.1| cytochrome c oxidase subunit [Chlamydomonas reinhardtii] gi|563695|gb|AAB93443.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|162009882|gb|ABX82064.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|162009891|gb|ABX82072.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|162009900|gb|ABX82080.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|162009909|gb|ABX82088.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|162009918|gb|ABX82096.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|162145622|gb|ABX82843.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|162145633|gb|ABX82853.1| cytochrome oxidase subunit 1 [Chlamydomonas reinhardtii] gi|225398|prf||1302139A cytochrome oxidase I Length = 505 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Query: 33 NLIQSLSFHERIYLIEFCFLFIQAGVSLQFFP-YFLNFGGFP 73 NLI L +HE ++ F LFI GV+L FFP +FL G P Sbjct: 392 NLITGLGYHEGRAMVHFWLLFI--GVNLTFFPQHFLGLAGMP 431 >gi|86553034|gb|ABC98214.1| cytochrome oxidase subunit 1 [Chlamydomonas incerta] Length = 505 Score = 35.4 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Query: 33 NLIQSLSFHERIYLIEFCFLFIQAGVSLQFFP-YFLNFGGFP 73 NLI L +HE ++ F LFI GV+L FFP +FL G P Sbjct: 392 NLITGLGYHEGRAMVHFWLLFI--GVNLTFFPQHFLGLAGMP 431 >gi|294845827|gb|ADF43068.1| cytochrome oxidase subunit I [Cognettia sphagnetorum] Length = 472 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 34 LIQSLSFHERIYLIEFCFLFIQAGVSLQFFP-YFLNFGGFPPIFCL 78 L L+ HER+ ++F +FI GV+L FFP +FL G P + L Sbjct: 377 LFSGLTLHERLTKVQFMLMFI--GVNLTFFPQHFLGLSGMPRRYSL 420 >gi|12514|emb|CAA47114.1| cytochrome-c oxidase [Chlamydomonas reinhardtii] gi|224955|prf||1204259C cytochrome oxidase I Length = 505 Score = 33.9 bits (76), Expect = 7.1, Method: Composition-based stats. Identities = 20/42 (47%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Query: 33 NLIQSLSFHERIYLIEFCFLFIQAGVSLQFFP-YFLNFGGFP 73 NLI L +HE ++ F LFI GV+L FFP +FL G P Sbjct: 392 NLITGLGYHEGRAMVHFWLLFI--GVNLTFFPQHFLGLVGMP 431 >gi|124262536|gb|ABM97463.1| cytochrome oxidase subunit I [Sepedophilus castaneus] gi|124262540|gb|ABM97465.1| cytochrome oxidase subunit I [Sepedophilus castaneus] Length = 275 Score = 33.9 bits (76), Expect = 7.5, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Query: 34 LIQSLSFHERIYLIEFCFLFIQAGVSLQFFP-YFLNFGGFP 73 L+ L+ HE++ I+F +FI GV+L FFP +FL G P Sbjct: 160 LLTGLTLHEKMLKIQFLTMFI--GVNLTFFPQHFLGLAGMP 198 >gi|124262532|gb|ABM97461.1| cytochrome oxidase subunit I [Sepedophilus castaneus] gi|124262534|gb|ABM97462.1| cytochrome oxidase subunit I [Sepedophilus castaneus] Length = 275 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Query: 34 LIQSLSFHERIYLIEFCFLFIQAGVSLQFFP-YFLNFGGFP 73 L+ L+ HE++ I+F +FI GV+L FFP +FL G P Sbjct: 160 LLTGLTLHEKMLKIQFLTMFI--GVNLTFFPQHFLGLAGMP 198 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.336 0.149 0.477 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 776,424,232 Number of extensions: 22719162 Number of successful extensions: 67294 Number of sequences better than 10.0: 20 Number of HSP's gapped: 67555 Number of HSP's successfully gapped: 20 Length of query: 99 Length of database: 5,058,227,080 Length adjustment: 68 Effective length of query: 31 Effective length of database: 4,053,341,304 Effective search space: 125653580424 Effective search space used: 125653580424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 76 (33.9 bits)