BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_5513_orf2 (157 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|221056504|ref|XP_002259390.1| Guanylyl cyclase [Plasmodium kn... 40 0.092 gi|34527268|dbj|BAC85357.1| unnamed protein product [Homo sapiens] 39 0.23 gi|290957417|ref|YP_003488599.1| hypothetical protein SCAB_29392... 34 9.0 >gi|221056504|ref|XP_002259390.1| Guanylyl cyclase [Plasmodium knowlesi strain H] gi|193809461|emb|CAQ40163.1| Guanylyl cyclase, putative [Plasmodium knowlesi strain H] Length = 3877 Score = 40.4 bits (93), Expect = 0.092, Method: Composition-based stats. Identities = 40/175 (22%), Positives = 74/175 (42%), Gaps = 41/175 (23%) Query: 12 VVGTHAPSQRRPRLACVVKPMGHRSGALLVVRGPPEDLANI------------------- 52 ++G + + +R R++ VVKP +SG++L V+G + ++ Sbjct: 1452 IIGINEFTNKRGRMSIVVKPEFMQSGSILYVKGSDTSILSLLDLKYSSFLEREGKRRRRK 1511 Query: 53 -------SQG-GIEALNAIEHGKVVLDTPRDKTRFXXXXXXXXXXXXGADEAPQICSKKE 104 SQG I + + G+ LD + K+ G + + + Sbjct: 1512 KKAHKERSQGRAIPTVLSSSKGRDKLDASQGKS-----------STSGINTDGECPHHRT 1560 Query: 105 ES--DAEQNGMRGQTCEDASRVRQILLAAQRSSLEGSLPFVYAVRVLSAEELALY 157 ++ DAE NG R ++C A R RQ+ ++ S++G V+A + L+ EE Y Sbjct: 1561 DAHLDAESNG-RSESCRFAKRYRQLEKQLRKFSVKGLRTMVFAFKYLNEEETVKY 1614 >gi|34527268|dbj|BAC85357.1| unnamed protein product [Homo sapiens] Length = 165 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 21/32 (65%) Query: 42 VRGPPEDLANISQGGIEALNAIEHGKVVLDTP 73 V GPP L +SQG I +L A EHG+ LDTP Sbjct: 91 VGGPPSPLGTLSQGKIRSLLATEHGRGWLDTP 122 >gi|290957417|ref|YP_003488599.1| hypothetical protein SCAB_29392 [Streptomyces scabiei 87.22] gi|260646943|emb|CBG70042.1| conserved hypothetical protein [Streptomyces scabiei 87.22] Length = 259 Score = 33.9 bits (76), Expect = 9.0, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Query: 28 VVKPMGHRSGALLVVRGPPEDLANISQGGIEALNAIEHGKVVLDTPRDKTR 78 +V+ M +GA+L+V P AN + IEAL ++H ++ +PRDKTR Sbjct: 125 IVREMAKSAGAILLV--DPSAAANRIRSAIEAL--LDHQRIRKTSPRDKTR 171 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.317 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,373,512,769 Number of extensions: 48471802 Number of successful extensions: 83278 Number of sequences better than 10.0: 8 Number of HSP's gapped: 83707 Number of HSP's successfully gapped: 8 Length of query: 157 Length of database: 5,058,227,080 Length adjustment: 119 Effective length of query: 38 Effective length of database: 3,299,676,972 Effective search space: 125387724936 Effective search space used: 125387724936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.9 bits)