BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_5425_orf7
         (64 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|290979960|ref|XP_002672701.1| predicted protein [Naegleria gr...    34     6.5  

>gi|290979960|ref|XP_002672701.1| predicted protein [Naegleria gruberi]
 gi|284086279|gb|EFC39957.1| predicted protein [Naegleria gruberi]
          Length = 183

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 13 ACTPSRHTAQKI----NMFKFACFTSSVWGSVNISNNCRTQIISLLSVYAPPKFY 63
          A T S+HT + I    ++    C    +W SV+I +NC++ I+ +L+    P FY
Sbjct: 2  ALTISQHTREYITQIFSLLGVLCSALIIWKSVSIYSNCQSPIVVVLTGSMEPAFY 56


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.328    0.135    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 579,912,732
Number of extensions: 14259422
Number of successful extensions: 32628
Number of sequences better than 10.0: 1
Number of HSP's gapped: 32726
Number of HSP's successfully gapped: 1
Length of query: 64
Length of database: 5,058,227,080
Length adjustment: 36
Effective length of query: 28
Effective length of database: 4,526,228,728
Effective search space: 126734404384
Effective search space used: 126734404384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 76 (33.9 bits)