BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_5307_orf1
         (98 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|340514226|gb|EGR44492.1| predicted protein [Trichoderma reese...    34     7.3  

>gi|340514226|gb|EGR44492.1| predicted protein [Trichoderma reesei QM6a]
          Length = 1607

 Score = 33.9 bits (76), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 39  GRNRDRTLGKGDTSKRRHLKKETLQKGDTSKRRHFKKETLQRRAQNPL 86
           G N++ +LG GD   R++ ++  LQ+ D   RR F+    Q+    PL
Sbjct: 240 GSNKNLSLGVGDEDDRQYPERIMLQRSDQLIRRFFEDYLTQKHVDAPL 287


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.312    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 960,462,308
Number of extensions: 35238443
Number of successful extensions: 131069
Number of sequences better than 10.0: 445
Number of HSP's gapped: 135739
Number of HSP's successfully gapped: 495
Length of query: 98
Length of database: 5,058,227,080
Length adjustment: 67
Effective length of query: 31
Effective length of database: 4,068,119,036
Effective search space: 126111690116
Effective search space used: 126111690116
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 76 (33.9 bits)