BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_5218_orf1 (94 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|157885952|emb|CAP09611.1| novel protein containing multiple s... 34 7.7 >gi|157885952|emb|CAP09611.1| novel protein containing multiple sushi domains (SCR repeat) [Danio rerio] Length = 837 Score = 33.9 bits (76), Expect = 7.7, Method: Composition-based stats. Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Query: 16 SWSSPCPGISTLTSTPPRWYEAPLSRNSLIIWYINVNILTYVLSLIYTQTHWSKCFCVNQ 75 +W +P STPP+ A ++ + +YI+ +I+TY +T S C+N Sbjct: 592 TWETPTCNAGVRCSTPPKVVNALITSKPKL-FYIDKSIVTYACRSPFTMKGQSTVSCLNG 650 Query: 76 KPFDSIVCYAKQAR 89 K ++ +C AK R Sbjct: 651 KWEETPICEAKCPR 664 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.328 0.138 0.477 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 936,688,100 Number of extensions: 32030794 Number of successful extensions: 106230 Number of sequences better than 10.0: 3 Number of HSP's gapped: 106630 Number of HSP's successfully gapped: 3 Length of query: 94 Length of database: 5,058,227,080 Length adjustment: 64 Effective length of query: 30 Effective length of database: 4,112,452,232 Effective search space: 123373566960 Effective search space used: 123373566960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.9 bits)