BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_5217_orf1 (138 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|146319687|ref|YP_001199399.1| DNA repair protein RadA [Strept... 37 1.1 gi|223934013|ref|ZP_03625968.1| DNA repair protein RadA [Strepto... 37 1.1 gi|322376097|ref|ZP_08050607.1| DNA repair protein RadA [Strepto... 37 1.3 gi|335029750|ref|ZP_08523255.1| DNA repair protein RadA [Strepto... 36 1.4 gi|334266117|gb|EGL84602.1| DNA repair protein RadA [Streptococc... 36 1.4 gi|322388500|ref|ZP_08062102.1| DNA repair protein RadA [Strepto... 36 1.5 gi|322391146|ref|ZP_08064618.1| DNA repair protein RadA [Strepto... 36 1.5 gi|168492310|ref|ZP_02716453.1| DNA repair protein RadA [Strepto... 36 1.5 gi|225860066|ref|YP_002741575.1| DNA repair protein RadA [Strept... 36 1.5 gi|148996427|ref|ZP_01824145.1| DNA repair protein RadA [Strepto... 36 1.5 gi|225855812|ref|YP_002737323.1| DNA repair protein RadA [Strept... 36 1.5 gi|149010884|ref|ZP_01832189.1| DNA repair protein RadA [Strepto... 36 1.6 gi|149006815|ref|ZP_01830501.1| DNA repair protein RadA [Strepto... 36 1.6 gi|15902069|ref|NP_357619.1| DNA repair protein RadA [Streptococ... 36 1.6 gi|148995211|ref|ZP_01824046.1| DNA repair protein RadA [Strepto... 36 1.7 gi|157150256|ref|YP_001449492.1| DNA repair protein RadA [Strept... 35 2.7 gi|262281811|ref|ZP_06059580.1| DNA repair protein RadA [Strepto... 35 3.0 gi|301799214|emb|CBW31727.1| putative DNA repair protein [Strept... 35 3.0 gi|335031985|ref|ZP_08525398.1| DNA repair protein RadA [Strepto... 35 3.1 gi|319940296|ref|ZP_08014648.1| DNA repair protein radA [Strepto... 35 3.3 gi|315222781|ref|ZP_07864668.1| DNA repair protein RadA [Strepto... 35 3.4 gi|322386670|ref|ZP_08060295.1| DNA repair protein RadA [Strepto... 35 3.4 gi|301793344|emb|CBW35705.1| putative DNA repair protein [Strept... 35 3.4 gi|307704432|ref|ZP_07641343.1| DNA repair protein RadA [Strepto... 35 4.9 gi|337282805|ref|YP_004622276.1| DNA repair protein RadA [Strept... 35 5.0 gi|309800214|ref|ZP_07694395.1| DNA repair protein RadA [Strepto... 35 5.0 gi|307706902|ref|ZP_07643703.1| DNA repair protein RadA [Strepto... 35 5.1 gi|340771312|gb|EGR93827.1| DNA repair protein RadA [Streptococc... 35 5.1 gi|307710062|ref|ZP_07646506.1| DNA repair protein RadA [Strepto... 35 5.1 gi|306828466|ref|ZP_07461661.1| DNA repair protein RadA [Strepto... 35 5.1 >gi|146319687|ref|YP_001199399.1| DNA repair protein RadA [Streptococcus suis 05ZYH33] gi|146321881|ref|YP_001201592.1| DNA repair protein RadA [Streptococcus suis 98HAH33] gi|253752681|ref|YP_003025822.1| DNA repair protein [Streptococcus suis SC84] gi|253754507|ref|YP_003027648.1| DNA repair protein [Streptococcus suis P1/7] gi|253756440|ref|YP_003029580.1| DNA repair protein [Streptococcus suis BM407] gi|145690493|gb|ABP90999.1| Predicted ATP-dependent serine protease [Streptococcus suis 05ZYH33] gi|145692687|gb|ABP93192.1| Predicted ATP-dependent serine protease [Streptococcus suis 98HAH33] gi|251816970|emb|CAZ52619.1| putative DNA repair protein [Streptococcus suis SC84] gi|251818904|emb|CAZ56747.1| putative DNA repair protein [Streptococcus suis BM407] gi|251820753|emb|CAR47515.1| putative DNA repair protein [Streptococcus suis P1/7] gi|292559300|gb|ADE32301.1| DNA repair protein RadA [Streptococcus suis GZ1] gi|319759097|gb|ADV71039.1| DNA repair protein RadA [Streptococcus suis JS14] Length = 455 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 327 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVALASSYKDKP 384 Query: 131 TNPE 134 TNP+ Sbjct: 385 TNPQ 388 >gi|223934013|ref|ZP_03625968.1| DNA repair protein RadA [Streptococcus suis 89/1591] gi|302024569|ref|ZP_07249780.1| DNA repair protein RadA [Streptococcus suis 05HAS68] gi|330833653|ref|YP_004402478.1| DNA repair protein [Streptococcus suis ST3] gi|223897327|gb|EEF63733.1| DNA repair protein RadA [Streptococcus suis 89/1591] gi|329307876|gb|AEB82292.1| DNA repair protein [Streptococcus suis ST3] Length = 456 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 327 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVALASSYKDKP 384 Query: 131 TNPE 134 TNP+ Sbjct: 385 TNPQ 388 >gi|322376097|ref|ZP_08050607.1| DNA repair protein RadA [Streptococcus sp. C300] gi|321279047|gb|EFX56090.1| DNA repair protein RadA [Streptococcus sp. C300] Length = 445 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 317 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 374 Query: 131 TNPE 134 TNP+ Sbjct: 375 TNPQ 378 >gi|335029750|ref|ZP_08523255.1| DNA repair protein RadA [Streptococcus infantis SK1076] gi|334268274|gb|EGL86716.1| DNA repair protein RadA [Streptococcus infantis SK1076] Length = 445 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 317 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 374 Query: 131 TNPE 134 TNP+ Sbjct: 375 TNPQ 378 >gi|334266117|gb|EGL84602.1| DNA repair protein RadA [Streptococcus oralis SK255] Length = 445 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 317 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 374 Query: 131 TNPE 134 TNP+ Sbjct: 375 TNPQ 378 >gi|322388500|ref|ZP_08062102.1| DNA repair protein RadA [Streptococcus infantis ATCC 700779] gi|321140618|gb|EFX36121.1| DNA repair protein RadA [Streptococcus infantis ATCC 700779] Length = 420 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|322391146|ref|ZP_08064618.1| DNA repair protein RadA [Streptococcus peroris ATCC 700780] gi|321145899|gb|EFX41288.1| DNA repair protein RadA [Streptococcus peroris ATCC 700780] Length = 420 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|168492310|ref|ZP_02716453.1| DNA repair protein RadA [Streptococcus pneumoniae CDC0288-04] gi|183573469|gb|EDT93997.1| DNA repair protein RadA [Streptococcus pneumoniae CDC0288-04] Length = 420 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|225860066|ref|YP_002741575.1| DNA repair protein RadA [Streptococcus pneumoniae Taiwan19F-14] gi|298229194|ref|ZP_06962875.1| DNA repair protein RadA [Streptococcus pneumoniae str. Canada MDR_19F] gi|298254026|ref|ZP_06977612.1| DNA repair protein RadA [Streptococcus pneumoniae str. Canada MDR_19A] gi|298501814|ref|YP_003723754.1| DNA repair protein RadA [Streptococcus pneumoniae TCH8431/19A] gi|225726622|gb|ACO22473.1| DNA repair protein RadA [Streptococcus pneumoniae Taiwan19F-14] gi|298237409|gb|ADI68540.1| DNA repair protein RadA [Streptococcus pneumoniae TCH8431/19A] gi|327390439|gb|EGE88779.1| DNA repair protein RadA [Streptococcus pneumoniae GA04375] Length = 420 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|148996427|ref|ZP_01824145.1| DNA repair protein RadA [Streptococcus pneumoniae SP11-BS70] gi|168576941|ref|ZP_02722783.1| DNA repair protein RadA [Streptococcus pneumoniae MLV-016] gi|307066705|ref|YP_003875671.1| putative ATP-dependent serine protease [Streptococcus pneumoniae AP200] gi|147757002|gb|EDK64041.1| DNA repair protein RadA [Streptococcus pneumoniae SP11-BS70] gi|183577404|gb|EDT97932.1| DNA repair protein RadA [Streptococcus pneumoniae MLV-016] gi|306408242|gb|ADM83669.1| Predicted ATP-dependent serine protease [Streptococcus pneumoniae AP200] gi|332201953|gb|EGJ16022.1| DNA repair protein RadA [Streptococcus pneumoniae GA41317] Length = 420 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|225855812|ref|YP_002737323.1| DNA repair protein RadA [Streptococcus pneumoniae P1031] gi|225725920|gb|ACO21772.1| DNA repair protein RadA [Streptococcus pneumoniae P1031] Length = 420 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|149010884|ref|ZP_01832189.1| DNA repair protein RadA [Streptococcus pneumoniae SP19-BS75] gi|182682993|ref|YP_001834740.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae CGSP14] gi|303255540|ref|ZP_07341597.1| DNA repair protein RadA [Streptococcus pneumoniae BS455] gi|303260659|ref|ZP_07346622.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae SP-BS293] gi|303260823|ref|ZP_07346772.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae SP14-BS292] gi|303263150|ref|ZP_07349073.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae BS397] gi|303267496|ref|ZP_07353346.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae BS457] gi|303269463|ref|ZP_07355230.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae BS458] gi|147764520|gb|EDK71450.1| DNA repair protein RadA [Streptococcus pneumoniae SP19-BS75] gi|182628327|gb|ACB89275.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae CGSP14] gi|301800995|emb|CBW33657.1| putative DNA repair protein [Streptococcus pneumoniae INV200] gi|302597501|gb|EFL64590.1| DNA repair protein RadA [Streptococcus pneumoniae BS455] gi|302637660|gb|EFL68146.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae SP14-BS292] gi|302638189|gb|EFL68661.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae SP-BS293] gi|302640997|gb|EFL71377.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae BS458] gi|302642971|gb|EFL73268.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae BS457] gi|302646923|gb|EFL77147.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae BS397] Length = 420 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|149006815|ref|ZP_01830501.1| DNA repair protein RadA [Streptococcus pneumoniae SP18-BS74] gi|169832478|ref|YP_001693546.1| DNA repair protein RadA [Streptococcus pneumoniae Hungary19A-6] gi|221230979|ref|YP_002510131.1| DNA repair protein [Streptococcus pneumoniae ATCC 700669] gi|225853651|ref|YP_002735163.1| DNA repair protein RadA [Streptococcus pneumoniae JJA] gi|307126253|ref|YP_003878284.1| DNA repair protein RadA [Streptococcus pneumoniae 670-6B] gi|147761730|gb|EDK68694.1| DNA repair protein RadA [Streptococcus pneumoniae SP18-BS74] gi|168994980|gb|ACA35592.1| DNA repair protein RadA [Streptococcus pneumoniae Hungary19A-6] gi|220673439|emb|CAR67902.1| putative DNA repair protein [Streptococcus pneumoniae ATCC 700669] gi|225722577|gb|ACO18430.1| DNA repair protein RadA [Streptococcus pneumoniae JJA] gi|306483315|gb|ADM90184.1| DNA repair protein RadA [Streptococcus pneumoniae 670-6B] gi|332076484|gb|EGI86946.1| DNA repair protein RadA [Streptococcus pneumoniae GA17545] Length = 420 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|15902069|ref|NP_357619.1| DNA repair protein RadA [Streptococcus pneumoniae R6] gi|111657252|ref|ZP_01408020.1| hypothetical protein SpneT_02001532 [Streptococcus pneumoniae TIGR4] gi|116516243|ref|YP_815444.1| DNA repair protein RadA [Streptococcus pneumoniae D39] gi|148985364|ref|ZP_01818569.1| DNA repair protein RadA [Streptococcus pneumoniae SP3-BS71] gi|148986209|ref|ZP_01819161.1| DNA repair protein RadA [Streptococcus pneumoniae SP3-BS71] gi|148987741|ref|ZP_01819204.1| DNA repair protein RadA [Streptococcus pneumoniae SP6-BS73] gi|149004176|ref|ZP_01828973.1| DNA repair protein RadA [Streptococcus pneumoniae SP14-BS69] gi|149023462|ref|ZP_01836051.1| DNA repair protein RadA [Streptococcus pneumoniae SP23-BS72] gi|168483674|ref|ZP_02708626.1| DNA repair protein RadA [Streptococcus pneumoniae CDC1873-00] gi|168486726|ref|ZP_02711234.1| DNA repair protein RadA [Streptococcus pneumoniae CDC1087-00] gi|168493716|ref|ZP_02717859.1| DNA repair protein RadA [Streptococcus pneumoniae CDC3059-06] gi|194397801|ref|YP_002036745.1| DNA repair protein RadA [Streptococcus pneumoniae G54] gi|225857886|ref|YP_002739396.1| DNA repair protein RadA [Streptococcus pneumoniae 70585] gi|237650018|ref|ZP_04524270.1| DNA repair protein RadA [Streptococcus pneumoniae CCRI 1974] gi|237822607|ref|ZP_04598452.1| DNA repair protein RadA [Streptococcus pneumoniae CCRI 1974M2] gi|15457555|gb|AAK98829.1| DNA repair: sensitivity to gamma and UV radiation [Streptococcus pneumoniae R6] gi|116076819|gb|ABJ54539.1| DNA repair protein RadA [Streptococcus pneumoniae D39] gi|147757838|gb|EDK64849.1| DNA repair protein RadA [Streptococcus pneumoniae SP14-BS69] gi|147921823|gb|EDK72951.1| DNA repair protein RadA [Streptococcus pneumoniae SP3-BS71] gi|147922322|gb|EDK73442.1| DNA repair protein RadA [Streptococcus pneumoniae SP3-BS71] gi|147926205|gb|EDK77278.1| DNA repair protein RadA [Streptococcus pneumoniae SP6-BS73] gi|147929785|gb|EDK80775.1| DNA repair protein RadA [Streptococcus pneumoniae SP23-BS72] gi|172042959|gb|EDT51005.1| DNA repair protein RadA [Streptococcus pneumoniae CDC1873-00] gi|183570304|gb|EDT90832.1| DNA repair protein RadA [Streptococcus pneumoniae CDC1087-00] gi|183576031|gb|EDT96559.1| DNA repair protein RadA [Streptococcus pneumoniae CDC3059-06] gi|194357468|gb|ACF55916.1| DNA repair protein RadA [Streptococcus pneumoniae G54] gi|225720045|gb|ACO15899.1| DNA repair protein RadA [Streptococcus pneumoniae 70585] gi|332077331|gb|EGI87792.1| DNA repair protein RadA [Streptococcus pneumoniae GA41301] gi|332204051|gb|EGJ18116.1| DNA repair protein RadA [Streptococcus pneumoniae GA47901] gi|332205055|gb|EGJ19118.1| DNA repair protein RadA [Streptococcus pneumoniae GA47368] Length = 420 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|148995211|ref|ZP_01824046.1| DNA repair protein RadA [Streptococcus pneumoniae SP9-BS68] gi|168489513|ref|ZP_02713712.1| DNA repair protein RadA [Streptococcus pneumoniae SP195] gi|147926813|gb|EDK77868.1| DNA repair protein RadA [Streptococcus pneumoniae SP9-BS68] gi|183572080|gb|EDT92608.1| DNA repair protein RadA [Streptococcus pneumoniae SP195] gi|332075680|gb|EGI86147.1| DNA repair protein RadA [Streptococcus pneumoniae GA17570] Length = 420 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|157150256|ref|YP_001449492.1| DNA repair protein RadA [Streptococcus gordonii str. Challis substr. CH1] gi|157075050|gb|ABV09733.1| DNA repair protein RadA [Streptococcus gordonii str. Challis substr. CH1] Length = 466 Score = 35.4 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 338 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDLP 395 Query: 131 TNPE 134 TNP+ Sbjct: 396 TNPQ 399 >gi|262281811|ref|ZP_06059580.1| DNA repair protein RadA [Streptococcus sp. 2_1_36FAA] gi|262262265|gb|EEY80962.1| DNA repair protein RadA [Streptococcus sp. 2_1_36FAA] Length = 445 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 317 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDLP 374 Query: 131 TNPE 134 TNP+ Sbjct: 375 TNPQ 378 >gi|301799214|emb|CBW31727.1| putative DNA repair protein [Streptococcus pneumoniae OXC141] Length = 420 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V + Y D Sbjct: 292 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASIYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|335031985|ref|ZP_08525398.1| DNA repair protein RadA [Streptococcus anginosus SK52] gi|333768267|gb|EGL45466.1| DNA repair protein RadA [Streptococcus anginosus SK52] Length = 475 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 347 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDLP 404 Query: 131 TNPE 134 TNP+ Sbjct: 405 TNPQ 408 >gi|319940296|ref|ZP_08014648.1| DNA repair protein radA [Streptococcus anginosus 1_2_62CV] gi|319810598|gb|EFW06934.1| DNA repair protein radA [Streptococcus anginosus 1_2_62CV] Length = 465 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 337 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDLP 394 Query: 131 TNPE 134 TNP+ Sbjct: 395 TNPQ 398 >gi|315222781|ref|ZP_07864668.1| DNA repair protein RadA [Streptococcus anginosus F0211] gi|315188144|gb|EFU21872.1| DNA repair protein RadA [Streptococcus anginosus F0211] Length = 467 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 339 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDLP 396 Query: 131 TNPE 134 TNP+ Sbjct: 397 TNPQ 400 >gi|322386670|ref|ZP_08060295.1| DNA repair protein RadA [Streptococcus cristatus ATCC 51100] gi|321269343|gb|EFX52278.1| DNA repair protein RadA [Streptococcus cristatus ATCC 51100] Length = 418 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 289 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDLP 346 Query: 131 TNPE 134 TNP+ Sbjct: 347 TNPQ 350 >gi|301793344|emb|CBW35705.1| putative DNA repair protein [Streptococcus pneumoniae INV104] Length = 420 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+++ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 292 GLDFNRASLIMSVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 349 Query: 131 TNPE 134 TNP+ Sbjct: 350 TNPQ 353 >gi|307704432|ref|ZP_07641343.1| DNA repair protein RadA [Streptococcus mitis SK597] gi|322378200|ref|ZP_08052684.1| DNA repair protein RadA [Streptococcus sp. M334] gi|307622005|gb|EFO01031.1| DNA repair protein RadA [Streptococcus mitis SK597] gi|321280830|gb|EFX57846.1| DNA repair protein RadA [Streptococcus sp. M334] gi|339457674|gb|EGP70241.1| DNA repair protein RadA [Streptococcus mitis SK1080] gi|339457932|gb|EGP70485.1| DNA repair protein RadA [Streptococcus mitis SK1073] Length = 407 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 279 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 336 Query: 131 TNPE 134 TNP+ Sbjct: 337 TNPQ 340 >gi|337282805|ref|YP_004622276.1| DNA repair protein RadA [Streptococcus parasanguinis ATCC 15912] gi|335370398|gb|AEH56348.1| DNA repair protein RadA [Streptococcus parasanguinis ATCC 15912] Length = 397 Score = 34.7 bits (78), Expect = 5.0, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 269 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 326 Query: 131 TNPE 134 TNP+ Sbjct: 327 TNPQ 330 >gi|309800214|ref|ZP_07694395.1| DNA repair protein RadA [Streptococcus infantis SK1302] gi|308116155|gb|EFO53650.1| DNA repair protein RadA [Streptococcus infantis SK1302] Length = 407 Score = 34.7 bits (78), Expect = 5.0, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 279 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 336 Query: 131 TNPE 134 TNP+ Sbjct: 337 TNPQ 340 >gi|307706902|ref|ZP_07643703.1| DNA repair protein RadA [Streptococcus mitis SK321] gi|307617694|gb|EFN96860.1| DNA repair protein RadA [Streptococcus mitis SK321] Length = 397 Score = 34.7 bits (78), Expect = 5.1, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 269 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 326 Query: 131 TNPE 134 TNP+ Sbjct: 327 TNPQ 330 >gi|340771312|gb|EGR93827.1| DNA repair protein RadA [Streptococcus mitis bv. 2 str. F0392] Length = 407 Score = 34.7 bits (78), Expect = 5.1, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 279 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 336 Query: 131 TNPE 134 TNP+ Sbjct: 337 TNPQ 340 >gi|307710062|ref|ZP_07646506.1| DNA repair protein RadA [Streptococcus mitis SK564] gi|307619042|gb|EFN98174.1| DNA repair protein RadA [Streptococcus mitis SK564] Length = 407 Score = 34.7 bits (78), Expect = 5.1, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 279 GLDFNRASLIMAVLGKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 336 Query: 131 TNPE 134 TNP+ Sbjct: 337 TNPQ 340 >gi|306828466|ref|ZP_07461661.1| DNA repair protein RadA [Streptococcus mitis ATCC 6249] gi|304429265|gb|EFM32350.1| DNA repair protein RadA [Streptococcus mitis ATCC 6249] Length = 397 Score = 34.7 bits (78), Expect = 5.1, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 72 GSDLHLRTLILALESKVAGLLRLIQETQASLKESG-LSFPFSAADGAVEVQFKAAYTDDL 130 G D + +LI+A+ K AGLL +Q A LK +G + A D AV V ++Y D Sbjct: 269 GLDFNRASLIMAVLEKRAGLL--LQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKP 326 Query: 131 TNPE 134 TNP+ Sbjct: 327 TNPQ 330 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.319 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 998,433,500 Number of extensions: 26683233 Number of successful extensions: 54396 Number of sequences better than 10.0: 52 Number of HSP's gapped: 54710 Number of HSP's successfully gapped: 52 Length of query: 138 Length of database: 5,058,227,080 Length adjustment: 103 Effective length of query: 35 Effective length of database: 3,536,120,684 Effective search space: 123764223940 Effective search space used: 123764223940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.9 bits)