BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_4873_orf2 (121 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|330752429|emb|CBL87379.1| dihydrodipicolinate synthetase [unc... 39 0.24 gi|330752596|emb|CBL87542.1| hypothetical protein S18_873_0036 [... 37 0.92 gi|330752598|emb|CBL87543.1| glycosyl transferase protein, famil... 37 0.99 gi|330752782|emb|CBL88301.1| hypothetical protein S18_841_0001 [... 37 1.0 gi|330752368|emb|CBL87320.1| hypothetical protein S18_1049_0001 ... 37 1.2 gi|241888666|ref|ZP_04775973.1| oligoendopeptidase F [Gemella ha... 35 2.8 gi|329767967|ref|ZP_08259478.1| hypothetical protein HMPREF0428_... 35 3.1 >gi|330752429|emb|CBL87379.1| dihydrodipicolinate synthetase [uncultured Flavobacteria bacterium] Length = 257 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 18/42 (42%) Query: 5 GKPGGFPIFFAWGNFPFSPVGFLGKRPARFPFPKFCPPCWGM 46 GK P A + P SP G + KRPA P C W M Sbjct: 189 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAAEWRM 230 >gi|330752596|emb|CBL87542.1| hypothetical protein S18_873_0036 [uncultured Flavobacteria bacterium] Length = 71 Score = 37.0 bits (84), Expect = 0.92, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 18/42 (42%) Query: 5 GKPGGFPIFFAWGNFPFSPVGFLGKRPARFPFPKFCPPCWGM 46 GK P A + P SP G + KRPA P C W M Sbjct: 3 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAAEWRM 44 >gi|330752598|emb|CBL87543.1| glycosyl transferase protein, family 1 [uncultured Flavobacteria bacterium] Length = 293 Score = 37.0 bits (84), Expect = 0.99, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 18/42 (42%) Query: 5 GKPGGFPIFFAWGNFPFSPVGFLGKRPARFPFPKFCPPCWGM 46 GK P A + P SP G + KRPA P C W M Sbjct: 225 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAAEWRM 266 >gi|330752782|emb|CBL88301.1| hypothetical protein S18_841_0001 [uncultured Dokdonia sp.] Length = 121 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 18/43 (41%) Query: 5 GKPGGFPIFFAWGNFPFSPVGFLGKRPARFPFPKFCPPCWGME 47 GK P A + P SP G + KRPA P C W M Sbjct: 53 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAAEWRMA 95 >gi|330752368|emb|CBL87320.1| hypothetical protein S18_1049_0001 [uncultured Sphingobacteria bacterium] Length = 99 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 18/43 (41%) Query: 5 GKPGGFPIFFAWGNFPFSPVGFLGKRPARFPFPKFCPPCWGME 47 GK P A + P SP G + KRPA P C W M Sbjct: 31 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAAEWRMA 73 >gi|241888666|ref|ZP_04775973.1| oligoendopeptidase F [Gemella haemolysans ATCC 10379] gi|241864689|gb|EER69064.1| oligoendopeptidase F [Gemella haemolysans ATCC 10379] Length = 563 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%) Query: 66 LFFYPLGEIGKIPFYFKKLTRIGVGCFPFWKK 97 LFFY G + +PFY+ T V F FWKK Sbjct: 471 LFFYRQGHLFSVPFYYIDYTLAQVCAFQFWKK 502 >gi|329767967|ref|ZP_08259478.1| hypothetical protein HMPREF0428_01175 [Gemella haemolysans M341] gi|328838452|gb|EGF88060.1| hypothetical protein HMPREF0428_01175 [Gemella haemolysans M341] Length = 563 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%) Query: 66 LFFYPLGEIGKIPFYFKKLTRIGVGCFPFWKK 97 LFFY G + +PFY+ T V F FWKK Sbjct: 471 LFFYRQGHLFSVPFYYIDYTLAQVCAFQFWKK 502 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.333 0.159 0.588 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,531,750,403 Number of extensions: 64875205 Number of successful extensions: 100760 Number of sequences better than 10.0: 9 Number of HSP's gapped: 101569 Number of HSP's successfully gapped: 9 Length of query: 121 Length of database: 5,058,227,080 Length adjustment: 88 Effective length of query: 33 Effective length of database: 3,757,786,664 Effective search space: 124006959912 Effective search space used: 124006959912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.9 bits)