BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_4873_orf1
         (100 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|145601539|ref|XP_365210.2| hypothetical protein MGG_01912 [Ma...    34     7.2  

>gi|145601539|ref|XP_365210.2| hypothetical protein MGG_01912 [Magnaporthe oryzae 70-15]
 gi|145009592|gb|EDJ94248.1| hypothetical protein MGG_01912 [Magnaporthe oryzae 70-15]
          Length = 766

 Score = 33.9 bits (76), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 36  LGPFIFKLGKVFVGGRFWGSLGNFPFWGGVLNFR 69
           LGP +  LG+V  GGR W + GN P+  GVL + 
Sbjct: 112 LGPAVGPLGRVAKGGRNWEATGNDPYLTGVLAYE 145


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.329    0.160    0.577 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 895,710,604
Number of extensions: 37881028
Number of successful extensions: 81726
Number of sequences better than 10.0: 23
Number of HSP's gapped: 82267
Number of HSP's successfully gapped: 25
Length of query: 100
Length of database: 5,058,227,080
Length adjustment: 69
Effective length of query: 31
Effective length of database: 4,038,563,572
Effective search space: 125195470732
Effective search space used: 125195470732
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 76 (33.9 bits)