BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_4731_orf2
         (107 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|255933155|ref|XP_002558048.1| Pc12g12340 [Penicillium chrysog...    35     4.5  

>gi|255933155|ref|XP_002558048.1| Pc12g12340 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582667|emb|CAP80861.1| Pc12g12340 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 467

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 42  PPRGGANFSPPFPKKNFGGNPPRLNGGTAPPVHPPGGKQ 80
           PP+ G   +PP     +G  PP+ +G  APP  PP G+Q
Sbjct: 74  PPQQGQYGAPPAQGGPYGATPPQPHGYHAPPAQPPYGQQ 112


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.310    0.139    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 1,707,200,226
Number of extensions: 97026163
Number of successful extensions: 291334
Number of sequences better than 10.0: 4843
Number of HSP's gapped: 298228
Number of HSP's successfully gapped: 7134
Length of query: 107
Length of database: 5,058,227,080
Length adjustment: 75
Effective length of query: 32
Effective length of database: 3,949,897,180
Effective search space: 126396709760
Effective search space used: 126396709760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 76 (33.9 bits)