BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_4198_orf1
         (122 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|289580967|ref|YP_003479433.1| RNA 3'-phosphate cyclase [Natri...    34     8.7  

>gi|289580967|ref|YP_003479433.1| RNA 3'-phosphate cyclase [Natrialba magadii ATCC 43099]
 gi|289530520|gb|ADD04871.1| RNA 3'-phosphate cyclase [Natrialba magadii ATCC 43099]
          Length = 372

 Score = 33.9 bits (76), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 53  TAATLGCPTPSAVLRFQTLRGLTLGFLSPAVQWGVPACRISRCCIINEAFESCSRYSGSS 112
           T A   CP  + VLR ++  G+ +   S   + GVPA R+       +A ++ ++++GS 
Sbjct: 246 TTAASACPGSAIVLRLESEDGVPVAGCSALGERGVPAERVG-----EDAADAANQFAGSE 300

Query: 113 GPLGATDRHL 122
               A DRHL
Sbjct: 301 ---AAVDRHL 307


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.324    0.133    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 1,051,278,773
Number of extensions: 32329059
Number of successful extensions: 71731
Number of sequences better than 10.0: 2
Number of HSP's gapped: 71912
Number of HSP's successfully gapped: 2
Length of query: 122
Length of database: 5,058,227,080
Length adjustment: 89
Effective length of query: 33
Effective length of database: 3,743,008,932
Effective search space: 123519294756
Effective search space used: 123519294756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 76 (33.9 bits)