BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_4181_orf3 (133 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|259148358|emb|CAY81605.1| EC1118_1L7_2542p [Saccharomyces cer... 36 2.0 gi|74644743|sp|O13579.1|YL379_YEAST RecName: Full=Putative uncha... 35 3.1 >gi|259148358|emb|CAY81605.1| EC1118_1L7_2542p [Saccharomyces cerevisiae EC1118] Length = 124 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 20/60 (33%), Positives = 28/60 (46%) Query: 1 KGSAPRPPRMPKSGIWQQTRKTASASSVHSTFSRKSTRRSGACTSGSTHIAGFTSDRKRM 60 +GS +P SGIW + +K + + V +F T SGA TSG G R R+ Sbjct: 24 RGSEVSLDTIPYSGIWARIKKISRETPVQISFWLYGTFLSGAITSGRKDSNGLNKSRTRL 83 >gi|74644743|sp|O13579.1|YL379_YEAST RecName: Full=Putative uncharacterized protein YLR379W gi|2340044|gb|AAB67281.1| Ylr379wp [Saccharomyces cerevisiae] Length = 124 Score = 35.4 bits (80), Expect = 3.1, Method: Compositional matrix adjust. Identities = 20/60 (33%), Positives = 28/60 (46%) Query: 1 KGSAPRPPRMPKSGIWQQTRKTASASSVHSTFSRKSTRRSGACTSGSTHIAGFTSDRKRM 60 +GS +P SGIW + +K + + V +F T SGA TSG G R R+ Sbjct: 24 RGSEVSLDTIPYSGIWPRIKKISRETPVQISFWLYGTFLSGAITSGRKDSNGLNKSRTRL 83 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.313 0.127 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,150,342,674 Number of extensions: 33596757 Number of successful extensions: 55919 Number of sequences better than 10.0: 5 Number of HSP's gapped: 56560 Number of HSP's successfully gapped: 5 Length of query: 133 Length of database: 5,058,227,080 Length adjustment: 98 Effective length of query: 35 Effective length of database: 3,610,009,344 Effective search space: 126350327040 Effective search space used: 126350327040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 76 (33.9 bits)