BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_4088_orf2 (95 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325120391|emb|CBZ55945.1| conserved hypothetical protein [Neo... 54 7e-06 gi|237835567|ref|XP_002367081.1| hypothetical protein TGME49_047... 44 0.007 gi|221485383|gb|EEE23664.1| conserved hypothetical protein [Toxo... 44 0.008 >gi|325120391|emb|CBZ55945.1| conserved hypothetical protein [Neospora caninum Liverpool] Length = 1220 Score = 53.9 bits (128), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 26/73 (35%), Positives = 43/73 (58%) Query: 1 DACLYQDRRSRIDVRVLTDLFVSRVRTPLPLSAVERAVVFLEGIFPATIQLRSNVITVDP 60 DAC+Y+D R ID RV D+++S+ + PL L VE + L G+ P + L +V+ Sbjct: 1132 DACVYRDPRKTIDTRVFVDMYISKSKLPLRLDVVEECLATLAGLAPDMLSLNGSVVAFAS 1191 Query: 61 SIDHLSVKKVVDS 73 +D ++ K+VD+ Sbjct: 1192 RLDAAALLKLVDA 1204 >gi|237835567|ref|XP_002367081.1| hypothetical protein TGME49_047040 [Toxoplasma gondii ME49] gi|211964745|gb|EEA99940.1| hypothetical protein TGME49_047040 [Toxoplasma gondii ME49] gi|221506246|gb|EEE31881.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 1140 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 43/73 (58%) Query: 1 DACLYQDRRSRIDVRVLTDLFVSRVRTPLPLSAVERAVVFLEGIFPATIQLRSNVITVDP 60 DAC+Y+D R ID RV D+++++ + PL L VE + L + P + L +V++ Sbjct: 1052 DACVYRDPRKTIDTRVFVDVYIAKSKLPLRLDVVEECLATLARVAPDMLSLNGSVVSFAS 1111 Query: 61 SIDHLSVKKVVDS 73 + D ++ K+VD+ Sbjct: 1112 AFDAAALVKLVDT 1124 >gi|221485383|gb|EEE23664.1| conserved hypothetical protein [Toxoplasma gondii GT1] Length = 1140 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 43/73 (58%) Query: 1 DACLYQDRRSRIDVRVLTDLFVSRVRTPLPLSAVERAVVFLEGIFPATIQLRSNVITVDP 60 DAC+Y+D R ID RV D+++++ + PL L VE + L + P + L +V++ Sbjct: 1052 DACVYRDPRKTIDTRVFVDVYIAKSKLPLRLDVVEECLATLARVAPDMLSLNGSVVSFAS 1111 Query: 61 SIDHLSVKKVVDS 73 + D ++ K+VD+ Sbjct: 1112 AFDAAALVKLVDT 1124 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.325 0.140 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 595,386,263 Number of extensions: 16446986 Number of successful extensions: 45837 Number of sequences better than 10.0: 3 Number of HSP's gapped: 45935 Number of HSP's successfully gapped: 3 Length of query: 95 Length of database: 5,058,227,080 Length adjustment: 64 Effective length of query: 31 Effective length of database: 4,112,452,232 Effective search space: 127486019192 Effective search space used: 127486019192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 76 (33.9 bits)