BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_3853_orf1 (199 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|118374609|ref|XP_001020492.1| hypothetical protein TTHERM_002... 36 3.1 gi|322705508|gb|EFY97093.1| hypothetical protein MAA_07389 [Meta... 35 4.7 gi|256078058|ref|XP_002575315.1| mdn1 midasin-related [Schistoso... 35 5.7 >gi|118374609|ref|XP_001020492.1| hypothetical protein TTHERM_00217210 [Tetrahymena thermophila] gi|89302259|gb|EAS00247.1| hypothetical protein TTHERM_00217210 [Tetrahymena thermophila SB210] Length = 1256 Score = 35.8 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Query: 7 PHCLRDNPECETFHETSLDERRSDCLRCTT-YFAGSRRVAVLLTLDGPSRNPESPITCSI 65 PH + NP C F +T ++ CL+C Y+ S + V +T+ N + TC I Sbjct: 1025 PHDVTSNPNCAQFSQTV----QNQCLQCQNLYYLNSNGICVGVTIPNCQNNTSNMNTCDI 1080 Query: 66 CM 67 CM Sbjct: 1081 CM 1082 >gi|322705508|gb|EFY97093.1| hypothetical protein MAA_07389 [Metarhizium anisopliae ARSEF 23] Length = 1027 Score = 35.4 bits (80), Expect = 4.7, Method: Compositional matrix adjust. Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 5/74 (6%) Query: 3 APAAPHCLRDNPECETFHETSLDER----RSDCLRCTTY-FAGSRRVAVLLTLDGPSRNP 57 +PAA H L E H + L ++ S+ LR T+ AGS RV V+ + G + P Sbjct: 764 SPAARHPLHKFYEFTVIHISELIKKPRTTLSEFLRDPTFGKAGSNRVLVIDCITGFAEQP 823 Query: 58 ESPITCSICMPSSS 71 +SP I PSSS Sbjct: 824 KSPAVAEIMKPSSS 837 >gi|256078058|ref|XP_002575315.1| mdn1 midasin-related [Schistosoma mansoni] gi|238660550|emb|CAZ31548.1| mdn1, midasin-related [Schistosoma mansoni] Length = 2491 Score = 35.0 bits (79), Expect = 5.7, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 8/70 (11%) Query: 114 DRPQQDGNDPCEVNVADDH--------DIVMPHELQLEQVHCHLPISDRRVLDMPDGPDH 165 D+P + ++ + +DDH D +P ++ +Q++ +++R V D+PD P Sbjct: 1841 DQPTDNKSESTQTKPSDDHETSDVDERDQGLPVDIDADQMNNEEDMTERDVEDLPDDPSS 1900 Query: 166 GEQDGATADE 175 G+ DG +E Sbjct: 1901 GQLDGEKDNE 1910 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.316 0.135 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 2,174,192,533 Number of extensions: 88906760 Number of successful extensions: 153938 Number of sequences better than 10.0: 9 Number of HSP's gapped: 154632 Number of HSP's successfully gapped: 9 Length of query: 199 Length of database: 5,058,227,080 Length adjustment: 132 Effective length of query: 67 Effective length of database: 3,107,566,456 Effective search space: 208206952552 Effective search space used: 208206952552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 78 (34.7 bits)