BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_3629_orf5 (107 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|115402935|ref|XP_001217544.1| conserved hypothetical protein ... 36 1.7 >gi|115402935|ref|XP_001217544.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114189390|gb|EAU31090.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 1213 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 6/104 (5%) Query: 4 CTTCYLNTPRLQSITESTRHLRRRDSQYALLNCVLIRLTNGLDARRKARNFIDAISTRKK 63 CTTC LN + +R D +++L + VL R G + + A D Sbjct: 329 CTTCILNNTHGHHPAHTFTLIR--DQEFSLKSLVLSRCKAGRNRQHSA--ICDGCEKMLT 384 Query: 64 SNWNAGVRHRCCTCHISHFC--CMHRQACCKRILRTATKWGPVS 105 S GVRH+C +C +C C + A R +GP++ Sbjct: 385 SQRITGVRHKCLSCPDWDYCAECHQKAAQTHPGHRFVPLYGPIA 428 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.330 0.135 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 957,312,776 Number of extensions: 30733673 Number of successful extensions: 91647 Number of sequences better than 10.0: 20 Number of HSP's gapped: 92017 Number of HSP's successfully gapped: 20 Length of query: 107 Length of database: 5,058,227,080 Length adjustment: 75 Effective length of query: 32 Effective length of database: 3,949,897,180 Effective search space: 126396709760 Effective search space used: 126396709760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 76 (33.9 bits)