BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_3629_orf3 (105 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|240256475|ref|NP_201137.5| nuclear protein X1 [Arabidopsis th... 35 2.6 gi|238481625|ref|NP_001154792.1| nuclear protein X1 [Arabidopsis... 35 4.9 >gi|240256475|ref|NP_201137.5| nuclear protein X1 [Arabidopsis thaliana] gi|327488242|sp|Q9FGW9.2|GTE10_ARATH RecName: Full=Transcription factor GTE10; AltName: Full=Bromodomain-containing protein GTE10; AltName: Full=Nuclear protein X1; AltName: Full=Protein GLOBAL TRANSCRIPTION FACTOR GROUP E10 gi|332010349|gb|AED97732.1| nuclear protein X1 [Arabidopsis thaliana] Length = 1061 Score = 35.4 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%) Query: 7 PHRSHRCRAGPRPFPSNCLANTLSCHKRKEPQRLQALRSQHSNLRRQDTRLHSLSSSAVQ 66 P+ H C GPR P A + +K P +RS ++ +RL+ +S V Sbjct: 104 PYNDHSCSDGPRRPPPENFATFVGSQGKKRP----PVRSDKQRNKKGPSRLNVPTSYTVA 159 Query: 67 PQLLRCHRLNHRLQRYQQG 85 + C L +RL ++ G Sbjct: 160 SVMKECETLLNRLWSHKSG 178 >gi|238481625|ref|NP_001154792.1| nuclear protein X1 [Arabidopsis thaliana] gi|238481627|ref|NP_001154793.1| nuclear protein X1 [Arabidopsis thaliana] gi|10177441|dbj|BAB10737.1| unnamed protein product [Arabidopsis thaliana] gi|50253452|gb|AAT71928.1| At5g63330 [Arabidopsis thaliana] gi|60543335|gb|AAX22265.1| At5g63330 [Arabidopsis thaliana] gi|332010350|gb|AED97733.1| nuclear protein X1 [Arabidopsis thaliana] gi|332010351|gb|AED97734.1| nuclear protein X1 [Arabidopsis thaliana] Length = 477 Score = 34.7 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%) Query: 7 PHRSHRCRAGPRPFPSNCLANTLSCHKRKEPQRLQALRSQHSNLRRQDTRLHSLSSSAVQ 66 P+ H C GPR P A + +K P +RS ++ +RL+ +S V Sbjct: 104 PYNDHSCSDGPRRPPPENFATFVGSQGKKRP----PVRSDKQRNKKGPSRLNVPTSYTVA 159 Query: 67 PQLLRCHRLNHRLQRYQQG 85 + C L +RL ++ G Sbjct: 160 SVMKECETLLNRLWSHKSG 178 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.327 0.131 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 959,676,956 Number of extensions: 30411432 Number of successful extensions: 103323 Number of sequences better than 10.0: 9 Number of HSP's gapped: 104178 Number of HSP's successfully gapped: 9 Length of query: 105 Length of database: 5,058,227,080 Length adjustment: 73 Effective length of query: 32 Effective length of database: 3,979,452,644 Effective search space: 127342484608 Effective search space used: 127342484608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.9 bits)