BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_3629_orf2 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|257057137|ref|YP_003134969.1| choline dehydrogenase [Saccharo... 39 1.6 >gi|257057137|ref|YP_003134969.1| choline dehydrogenase [Saccharomonospora viridis DSM 43017] gi|256587009|gb|ACU98142.1| choline dehydrogenase [Saccharomonospora viridis DSM 43017] Length = 554 Score = 39.3 bits (90), Expect = 1.6, Method: Compositional matrix adjust. Identities = 40/149 (26%), Positives = 62/149 (41%), Gaps = 6/149 (4%) Query: 188 FGSRAQNALAAGLPVHTAEVGDVTGAAPVTDTSVPVGFLSSANGVYKVP---RFPSGVQS 244 FG+ + A AG P+ + G D ++ G SA+ Y P R VQ Sbjct: 159 FGAFLEAAKQAGYPLTSDVNGYQQEGFAAFDRNIKNGRRWSASRAYLHPVKHRPNLTVQC 218 Query: 245 VSEPNEDAIK-KCILRISASQMTSGFSDTLKSGGVQITGSAFS--QLLRLVGTSSPRYTS 301 ++ N+ K + +S ++ S+ + G V + G A + QLL+L G PR+ Sbjct: 219 LTHVNQVLFNGKKAIGVSVTRFGRRKSENIYGGEVILCGGAINTPQLLQLSGVGDPRHLQ 278 Query: 302 KLSAPIVLFQRAVGTRISYEIRVAVPQGC 330 L PIV VG + + V V C Sbjct: 279 PLGIPIVQDLPGVGENLQDHLEVYVQHAC 307 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.318 0.133 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 4,132,004,368 Number of extensions: 149481973 Number of successful extensions: 333177 Number of sequences better than 10.0: 2 Number of HSP's gapped: 333975 Number of HSP's successfully gapped: 2 Length of query: 493 Length of database: 5,058,227,080 Length adjustment: 144 Effective length of query: 349 Effective length of database: 2,930,233,672 Effective search space: 1022651551528 Effective search space used: 1022651551528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 83 (36.6 bits)