BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2433_orf2 (142 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|309359325|emb|CAP33000.2| hypothetical protein CBG_14498 [Cae... 37 1.2 gi|268579157|ref|XP_002644561.1| Hypothetical protein CBG14498 [... 37 1.3 >gi|309359325|emb|CAP33000.2| hypothetical protein CBG_14498 [Caenorhabditis briggsae AF16] Length = 431 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Query: 61 LAHRTKTIQPVLSSRFARSLRKSVITSWKCLSNGATLPHTTFKCHLDSNTWGSVV 115 L+ +KTI L S F+ +KSVI KC+S +LP TT C +D N +G V Sbjct: 86 LSEVSKTIM-YLCSPFSMKRQKSVIEHQKCISGVLSLPATT-GCQMDDNDYGKQV 138 >gi|268579157|ref|XP_002644561.1| Hypothetical protein CBG14498 [Caenorhabditis briggsae] Length = 449 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Query: 61 LAHRTKTIQPVLSSRFARSLRKSVITSWKCLSNGATLPHTTFKCHLDSNTWGSVV 115 L+ +KTI L S F+ +KSVI KC+S +LP TT C +D N +G V Sbjct: 86 LSEVSKTIM-YLCSPFSMKRQKSVIEHQKCISGVLSLPATT-GCQMDDNDYGKQV 138 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.327 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,189,178,106 Number of extensions: 39961027 Number of successful extensions: 102951 Number of sequences better than 10.0: 2 Number of HSP's gapped: 103429 Number of HSP's successfully gapped: 2 Length of query: 142 Length of database: 5,058,227,080 Length adjustment: 106 Effective length of query: 36 Effective length of database: 3,491,787,488 Effective search space: 125704349568 Effective search space used: 125704349568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.9 bits)