BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2232_orf3 (111 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325002279|ref|ZP_08123391.1| transcriptional regulator, MerR ... 37 0.68 gi|306821556|ref|ZP_07455154.1| hydroxyethylthiazole kinase [Eub... 36 2.0 >gi|325002279|ref|ZP_08123391.1| transcriptional regulator, MerR family protein [Pseudonocardia sp. P1] Length = 243 Score = 37.4 bits (85), Expect = 0.68, Method: Compositional matrix adjust. Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Query: 3 YRKLWLGFRGRTLKHCVCASLAETLTALPQCTDKPGPAAYKVGRYEEKAAANYTVRETPR 62 YR +G R L+ A+L L+ALP D P A + + +AAA+ R T R Sbjct: 36 YRHYDVGHLVRLLRITRMAALGIPLSALPGVLDDPAAAEELLDELDRRAAADIE-RLTAR 94 Query: 63 KCMKSSQTASSSPCGLPIRLSAISAEAPVGVPGE 96 + ++ +S +P LP LSA + G P + Sbjct: 95 RADIAALRSSGAPPDLPPELSAWRSAPGEGTPAD 128 >gi|306821556|ref|ZP_07455154.1| hydroxyethylthiazole kinase [Eubacterium yurii subsp. margaretiae ATCC 43715] gi|304550301|gb|EFM38294.1| hydroxyethylthiazole kinase [Eubacterium yurii subsp. margaretiae ATCC 43715] Length = 270 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 3/89 (3%) Query: 11 RGRTLKHC--VCASLAETLTALPQCTDKPGPAAYKVGRYEEKAAANYTVRETPRKCMKSS 68 + + H +C +++E ++ T K YK Y K Y + T CM +S Sbjct: 142 KNMEINHIAKICKNISEKYDSVVTATGKNDIIVYKNDTYVVKNGVAYMSKITGTGCMSAS 201 Query: 69 QTASSSPCGL-PIRLSAISAEAPVGVPGE 96 TAS I LS + A A +GV GE Sbjct: 202 VTASFLAANKDDILLSTVYAIATMGVAGE 230 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.316 0.131 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,097,345,281 Number of extensions: 37406448 Number of successful extensions: 91092 Number of sequences better than 10.0: 3 Number of HSP's gapped: 92022 Number of HSP's successfully gapped: 3 Length of query: 111 Length of database: 5,058,227,080 Length adjustment: 79 Effective length of query: 32 Effective length of database: 3,890,786,252 Effective search space: 124505160064 Effective search space used: 124505160064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 76 (33.9 bits)