BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2232_orf1 (112 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|300712450|ref|YP_003738263.1| 3-polyprenyl-4-hydroxybenzoate ... 39 0.28 >gi|300712450|ref|YP_003738263.1| 3-polyprenyl-4-hydroxybenzoate decarboxylase and related decarboxylase-like protein [Halalkalicoccus jeotgali B3] gi|299126134|gb|ADJ16472.1| 3-polyprenyl-4-hydroxybenzoate decarboxylase and related decarboxylase-like protein [Halalkalicoccus jeotgali B3] Length = 463 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 2/91 (2%) Query: 23 AALGLPQAHPRGLRRIWQIALLVAHKGTTTLSGWISCIYEGSLEQCNLPQLSLHICRLCK 82 A+LGLP P G ++I + V H+G T+ + I+ S + ++PQ + C Sbjct: 123 ASLGLPTVEPNGRQQITLGLIAVEHEGMTSWAPVRGAIHRRSQLRLSVPQPFIEWCG-DN 181 Query: 83 RQARVCLCTGVTP-SEFLQGWRKHNASGSSP 112 RQA + L P LQGW + + P Sbjct: 182 RQASISLGIAAAPLVTALQGWTLDRTTSAVP 212 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.326 0.137 0.479 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,088,074,015 Number of extensions: 38663131 Number of successful extensions: 89248 Number of sequences better than 10.0: 2 Number of HSP's gapped: 89531 Number of HSP's successfully gapped: 2 Length of query: 112 Length of database: 5,058,227,080 Length adjustment: 80 Effective length of query: 32 Effective length of database: 3,876,008,520 Effective search space: 124032272640 Effective search space used: 124032272640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 76 (33.9 bits)