BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2219_orf2 (162 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|189424122|ref|YP_001951299.1| periplasmic nitrate reductase, ... 37 1.0 >gi|189424122|ref|YP_001951299.1| periplasmic nitrate reductase, large subunit [Geobacter lovleyi SZ] gi|189420381|gb|ACD94779.1| periplasmic nitrate reductase, large subunit [Geobacter lovleyi SZ] Length = 770 Score = 37.0 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 5/75 (6%) Query: 80 KCLYTQCTSQIRSLSLTSPHRG---YRAAFVVASAMKMLLWKHQDSNVTSPSGAWIPGS- 135 KCL+ QCT+ +S+ S +R R AF+V S + + ++V PS +W+ Sbjct: 459 KCLWIQCTNPFQSIPNLSRYRKAAQARKAFIVVSDIYPTR-STEVADVILPSASWVEKEG 517 Query: 136 VFVVTQRRVPVWNKI 150 VF T+RR W K+ Sbjct: 518 VFGNTERRTQHWFKM 532 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.326 0.133 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,276,455,061 Number of extensions: 40191315 Number of successful extensions: 102501 Number of sequences better than 10.0: 1 Number of HSP's gapped: 103022 Number of HSP's successfully gapped: 1 Length of query: 162 Length of database: 5,058,227,080 Length adjustment: 123 Effective length of query: 39 Effective length of database: 3,240,566,044 Effective search space: 126382075716 Effective search space used: 126382075716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 76 (33.9 bits)