BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2031_orf2 (124 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|93005688|ref|YP_580125.1| AraC family transcriptional regulat... 35 2.8 >gi|93005688|ref|YP_580125.1| AraC family transcriptional regulator [Psychrobacter cryohalolentis K5] gi|92393366|gb|ABE74641.1| transcriptional regulator, AraC family with amidase-like domain protein [Psychrobacter cryohalolentis K5] Length = 348 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 8/116 (6%) Query: 5 PASCGGVD-AENCVALRCTGSSGSWYEIPKRVHRRCSTRNMSVRSRKTLGALPQPSTALS 63 P S +D A + C ++Y++ + R R +S + KT + S Sbjct: 169 PKSQPKIDSAHQSGNIFCAAGGSAFYDLGLLLIERYCGREISTQVAKTQIIDSKRGNQNS 228 Query: 64 HTVISIHRPG----CTSVMYMLNESFTKSI---GLAAMALRIPASKKRSACSCVRM 112 +T +++H+P V + E+F +SI GLAAM P + R SCV M Sbjct: 229 YTNVTLHKPHSDQLVKQVQEFIEENFKQSIQVSGLAAMVNITPRTLNRRFQSCVAM 284 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.321 0.129 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,097,971,308 Number of extensions: 36212371 Number of successful extensions: 79599 Number of sequences better than 10.0: 1 Number of HSP's gapped: 80064 Number of HSP's successfully gapped: 1 Length of query: 124 Length of database: 5,058,227,080 Length adjustment: 90 Effective length of query: 34 Effective length of database: 3,728,231,200 Effective search space: 126759860800 Effective search space used: 126759860800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 76 (33.9 bits)