BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2023_orf5 (157 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|294888962|ref|XP_002772642.1| wimple/ift172, putative [Perkin... 39 0.28 gi|47499241|gb|AAT28386.1| capsid protein [Bovine enteric calici... 35 2.5 gi|194765138|ref|XP_001964684.1| GF23317 [Drosophila ananassae] ... 35 4.9 >gi|294888962|ref|XP_002772642.1| wimple/ift172, putative [Perkinsus marinus ATCC 50983] gi|239877052|gb|EER04458.1| wimple/ift172, putative [Perkinsus marinus ATCC 50983] Length = 1335 Score = 38.9 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 8/63 (12%) Query: 28 WVAKWWVRGPMRRGLSTRQ--------FPAAVKMEVKSCLYSPAVLGTFPASTSAKICCT 79 WV W V +++ + TRQ + AA+ C YSP V+ +P S+K+ CT Sbjct: 1244 WVLGWSVDNRVQQQMKTRQCDGCENEIYAAALVCPKCDCRYSPCVVTGYPVLASSKVECT 1303 Query: 80 CCQ 82 C+ Sbjct: 1304 NCR 1306 >gi|47499241|gb|AAT28386.1| capsid protein [Bovine enteric calicivirus] Length = 522 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 26/38 (68%) Query: 36 GPMRRGLSTRQFPAAVKMEVKSCLYSPAVLGTFPASTS 73 GP+ + +S+R FPA+V+ + C S +LGT P+S++ Sbjct: 241 GPIMQMMSSRTFPASVQFQNGRCTLSGDLLGTTPSSSA 278 >gi|194765138|ref|XP_001964684.1| GF23317 [Drosophila ananassae] gi|190614956|gb|EDV30480.1| GF23317 [Drosophila ananassae] Length = 520 Score = 34.7 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 21/77 (27%), Positives = 34/77 (44%) Query: 2 MPLGKKSGSLRAREAKKGKRDFDRFLWVAKWWVRGPMRRGLSTRQFPAAVKMEVKSCLYS 61 + L +K+ +L+ + D L V K + +R G S +Q V + LY Sbjct: 227 LKLNEKADALKVVNIALTDKPHDIKLLVKKMEIEALIRTGTSNQQPQPKVGLSRSPTLYE 286 Query: 62 PAVLGTFPASTSAKICC 78 G +PAST +K+ C Sbjct: 287 MGCRGMYPASTDSKLVC 303 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.326 0.136 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,062,592,810 Number of extensions: 31570371 Number of successful extensions: 74858 Number of sequences better than 10.0: 4 Number of HSP's gapped: 75041 Number of HSP's successfully gapped: 4 Length of query: 157 Length of database: 5,058,227,080 Length adjustment: 119 Effective length of query: 38 Effective length of database: 3,299,676,972 Effective search space: 125387724936 Effective search space used: 125387724936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 76 (33.9 bits)