BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2023_orf3 (160 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325116635|emb|CBZ52188.1| hypothetical protein NCLIV_019770 [... 62 4e-08 gi|237844269|ref|XP_002371432.1| non-transmembrane antigen [Toxo... 53 1e-05 gi|221501906|gb|EEE27657.1| non-transmembrane antigen, putative ... 52 3e-05 >gi|325116635|emb|CBZ52188.1| hypothetical protein NCLIV_019770 [Neospora caninum Liverpool] Length = 520 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 2/92 (2%) Query: 71 ILAEVEAGKVPKTAGEYKQLFTSILTAAGNWRVD-KPLRIGPLTHHLATH-KNLSKSLLP 128 IL V AG P + L +L GN R + +P+R L +L ++ + LP Sbjct: 33 ILNVVAAGDGPANPDQLANLHKRLLQLTGNLRTENRPIRQDALLKYLESNSRKFFSHDLP 92 Query: 129 FLASLARRLPDFFPSGIRHLGRDNPAVHLRRI 160 LA+L RL DFFPSG++ + +NP VHLR+I Sbjct: 93 LLAALVSRLDDFFPSGLQFITPENPQVHLRKI 124 >gi|237844269|ref|XP_002371432.1| non-transmembrane antigen [Toxoplasma gondii ME49] gi|211969096|gb|EEB04292.1| non-transmembrane antigen [Toxoplasma gondii ME49] gi|221481293|gb|EEE19690.1| non-transmembrane antigen, putative [Toxoplasma gondii GT1] Length = 553 Score = 53.1 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 3/93 (3%) Query: 71 ILAEVEAGKVPKTAGEYKQLFTSILTAAGNWRVDKPLRI---GPLTHHLATHKNLSKSLL 127 IL V +G P + L +L +GN R +K RI G L + L Sbjct: 63 ILNFVASGFGPADPQQLASLQKRLLKLSGNIRTEKNKRILQRGLLNYLEENPGKFFSHDL 122 Query: 128 PFLASLARRLPDFFPSGIRHLGRDNPAVHLRRI 160 PF+A+L R+ + FPSG++++ +NP VHLR+I Sbjct: 123 PFMATLVMRIDELFPSGLQYITPENPQVHLRKI 155 >gi|221501906|gb|EEE27657.1| non-transmembrane antigen, putative [Toxoplasma gondii VEG] Length = 553 Score = 52.0 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 48/93 (51%), Gaps = 3/93 (3%) Query: 71 ILAEVEAGKVPKTAGEYKQLFTSILTAAGNWRVDKPLRI---GPLTHHLATHKNLSKSLL 127 IL V +G P + L +L +GN R +K RI G L + L Sbjct: 63 ILNFVASGFGPADPQQLASLQKRLLKLSGNIRTEKNKRILQRGLLNYLEENPGKFFSHDL 122 Query: 128 PFLASLARRLPDFFPSGIRHLGRDNPAVHLRRI 160 PF+A+L R+ + FP+G++++ +NP VHLR+I Sbjct: 123 PFMATLVMRIDELFPNGLQYITPENPQVHLRKI 155 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.323 0.139 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 946,533,313 Number of extensions: 32144057 Number of successful extensions: 60697 Number of sequences better than 10.0: 6 Number of HSP's gapped: 60962 Number of HSP's successfully gapped: 6 Length of query: 160 Length of database: 5,058,227,080 Length adjustment: 122 Effective length of query: 38 Effective length of database: 3,255,343,776 Effective search space: 123703063488 Effective search space used: 123703063488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 76 (33.9 bits)