BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_2023_orf2 (178 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|261211560|ref|ZP_05925848.1| sigma factor RpoE negative regul... 36 2.1 gi|170094736|ref|XP_001878589.1| predicted protein [Laccaria bic... 35 3.6 >gi|261211560|ref|ZP_05925848.1| sigma factor RpoE negative regulatory protein RseA [Vibrio sp. RC341] gi|260839515|gb|EEX66141.1| sigma factor RpoE negative regulatory protein RseA [Vibrio sp. RC341] Length = 204 Score = 36.2 bits (82), Expect = 2.1, Method: Compositional matrix adjust. Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Query: 117 WKLARGQAPA--HRPPHPPLGHPQKSVEISFA-LFGFPRP-QTPRLLPQWHSSFG 167 W +A A A + P H PL H QK +++ A L P+P Q R LP W + FG Sbjct: 54 WNIAESVALALENEPAHNPLTHSQKVIDLQQARLEAQPKPQQAKRQLPTWLTQFG 108 >gi|170094736|ref|XP_001878589.1| predicted protein [Laccaria bicolor S238N-H82] gi|164647043|gb|EDR11288.1| predicted protein [Laccaria bicolor S238N-H82] Length = 1146 Score = 35.4 bits (80), Expect = 3.6, Method: Compositional matrix adjust. Identities = 23/95 (24%), Positives = 41/95 (43%), Gaps = 13/95 (13%) Query: 97 KSSQDSWGVQTALHFHLNCCWKLARGQAPAHRPPHPP-----LGHPQKSV--EISFALFG 149 + ++ SW + ++L+ CWKL+R H P H L HP + I + + Sbjct: 469 RRTEGSWKREFIARYNLSRCWKLSRNVTTTHDPLHTAITSVHLMHPLSVLASSIQYGIVS 528 Query: 150 FPRPQTPRLLPQW------HSSFGAGQPGSAFAAN 178 P T ++LP + + G G P + F+ + Sbjct: 529 RSIPLTGKVLPGYLDASGFRAGLGIGNPTTQFSPD 563 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.321 0.135 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,174,956,788 Number of extensions: 41167257 Number of successful extensions: 97754 Number of sequences better than 10.0: 9 Number of HSP's gapped: 98753 Number of HSP's successfully gapped: 9 Length of query: 178 Length of database: 5,058,227,080 Length adjustment: 130 Effective length of query: 48 Effective length of database: 3,137,121,920 Effective search space: 150581852160 Effective search space used: 150581852160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 76 (33.9 bits)