BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_1973_orf3
         (103 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|78063790|ref|YP_373698.1| hypothetical protein Bcep18194_B294...    35     3.4  

>gi|78063790|ref|YP_373698.1| hypothetical protein Bcep18194_B2943 [Burkholderia sp. 383]
 gi|77971675|gb|ABB13054.1| conserved hypothetical protein [Burkholderia sp. 383]
          Length = 465

 Score = 35.0 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 24  LQIYSPQIYSNLKAKFSEWSGSSSRPGAPCRWTRPVSSQSTSPDPSRASLERFCHTFL-P 82
           L +  PQ+     A   EW G++S PGA    T  VS+    P   RA LE +    L P
Sbjct: 397 LSVQYPQVRQVRYANAFEWDGAASAPGADAVPTFVVSTAKPMPRAERARLEAWLKVRLGP 456

Query: 83  RP 84
           +P
Sbjct: 457 KP 458


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.316    0.130    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 986,362,994
Number of extensions: 36924327
Number of successful extensions: 103006
Number of sequences better than 10.0: 11
Number of HSP's gapped: 104060
Number of HSP's successfully gapped: 11
Length of query: 103
Length of database: 5,058,227,080
Length adjustment: 72
Effective length of query: 31
Effective length of database: 3,994,230,376
Effective search space: 123821141656
Effective search space used: 123821141656
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 76 (33.9 bits)