BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_1800_orf2 (78 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|159185913|ref|NP_356783.2| hypothetical protein Atu3843 [Agro... 34 6.4 >gi|159185913|ref|NP_356783.2| hypothetical protein Atu3843 [Agrobacterium tumefaciens str. C58] gi|159141047|gb|AAK89568.2| Hypothetical Protein Atu3843 [Agrobacterium tumefaciens str. C58] Length = 380 Score = 34.3 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 11/84 (13%) Query: 1 PSGFPVAPNKTRSQAQMIRAWKGGNRGGEP-------KIELKETAESGKKASRQADRIKR 53 P+ F + KTR Q +M R+ G +GG P K E + + G+ A R +K Sbjct: 49 PTSFDIDDEKTRQQLRMSRSVGGWYKGGRPATRVPSRKAEDYKVSAEGRDAPRYMREVKN 108 Query: 54 L-KSAKRG---LLPAPEKTLRIVL 73 L + AK G ++P P T ++ Sbjct: 109 LYEDAKPGDLVIIPGPGYTSEVLF 132 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.311 0.129 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 760,252,548 Number of extensions: 24484974 Number of successful extensions: 57992 Number of sequences better than 10.0: 5 Number of HSP's gapped: 58543 Number of HSP's successfully gapped: 5 Length of query: 78 Length of database: 5,058,227,080 Length adjustment: 49 Effective length of query: 29 Effective length of database: 4,334,118,212 Effective search space: 125689428148 Effective search space used: 125689428148 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 76 (33.9 bits)