BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_1775_orf3 (139 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|325118656|emb|CBZ54207.1| conserved hypothetical protein [Neo... 52 2e-05 gi|221486533|gb|EEE24794.1| conserved hypothetical protein [Toxo... 52 3e-05 gi|237834027|ref|XP_002366311.1| hypothetical protein TGME49_026... 52 3e-05 >gi|325118656|emb|CBZ54207.1| conserved hypothetical protein [Neospora caninum Liverpool] Length = 384 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 4/97 (4%) Query: 44 SGESEAKSGKTXXXXXXXDRKSFDKEQKQKNEAFWRNLLQEIGVXXXXXXXXXKTWKDKL 103 S E +S + +R +E +++N+ FWR++ E GV WK +L Sbjct: 13 SSEERTQSQVSEAPLEDPERTRRVQEARRRNDKFWRDVFAETGVRRYRSHVEDSVWKQRL 72 Query: 104 --ACFGFVCLAALVASEFGYRMYMGLHYGFETIDTSD 138 A FV +A + ++ YR Y+ L++GF ID +D Sbjct: 73 TIAAVAFVIIAGI--TQAIYRAYLDLNFGFRNIDVTD 107 >gi|221486533|gb|EEE24794.1| conserved hypothetical protein [Toxoplasma gondii GT1] gi|221508301|gb|EEE33888.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 380 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 4/73 (5%) Query: 68 KEQKQKNEAFWRNLLQEIGVXXXXXXXXXKTWKDKL--ACFGFVCLAALVASEFGYRMYM 125 +E +++N+ FWR++ E GV WK +L A FV +A + ++ YR Y+ Sbjct: 38 QEARRRNDKFWRDVFAETGVRRYRNNVEENVWKQRLTIAAVAFVIIAGI--TQAIYRAYL 95 Query: 126 GLHYGFETIDTSD 138 L++GF ID +D Sbjct: 96 DLNFGFRNIDVTD 108 >gi|237834027|ref|XP_002366311.1| hypothetical protein TGME49_026580 [Toxoplasma gondii ME49] gi|211963975|gb|EEA99170.1| hypothetical protein TGME49_026580 [Toxoplasma gondii ME49] Length = 380 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 4/73 (5%) Query: 68 KEQKQKNEAFWRNLLQEIGVXXXXXXXXXKTWKDKL--ACFGFVCLAALVASEFGYRMYM 125 +E +++N+ FWR++ E GV WK +L A FV +A + ++ YR Y+ Sbjct: 38 QEARRRNDKFWRDVFAETGVRRYRNNVEENVWKQRLTIAAVAFVIIAGI--TQAIYRAYL 95 Query: 126 GLHYGFETIDTSD 138 L++GF ID +D Sbjct: 96 DLNFGFRNIDVTD 108 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.317 0.131 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 786,313,089 Number of extensions: 21586677 Number of successful extensions: 27859 Number of sequences better than 10.0: 4 Number of HSP's gapped: 27901 Number of HSP's successfully gapped: 4 Length of query: 139 Length of database: 5,058,227,080 Length adjustment: 103 Effective length of query: 36 Effective length of database: 3,536,120,684 Effective search space: 127300344624 Effective search space used: 127300344624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.9 bits)