BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_1648_orf6 (124 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|168013254|ref|XP_001759316.1| predicted protein [Physcomitrel... 34 6.5 gi|302775122|ref|XP_002970978.1| hypothetical protein SELMODRAFT... 34 8.3 >gi|168013254|ref|XP_001759316.1| predicted protein [Physcomitrella patens subsp. patens] gi|162689629|gb|EDQ76000.1| predicted protein [Physcomitrella patens subsp. patens] Length = 828 Score = 34.3 bits (77), Expect = 6.5, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 7/68 (10%) Query: 5 NAPRRNTSGREKTGTVAPP-------NGSRVTAHLHTLTSEEANHGLCGPCSIARPVVSA 57 N +NT G + T A P S +A+ T + EEA H LCGP RP+ Sbjct: 55 NGKEKNTLGWKSTHLSARPLTICRVAGVSSDSANTETESKEEAGHRLCGPPLRGRPLPFG 114 Query: 58 VESVSEGI 65 + EG+ Sbjct: 115 ATACEEGV 122 >gi|302775122|ref|XP_002970978.1| hypothetical protein SELMODRAFT_441343 [Selaginella moellendorffii] gi|300160960|gb|EFJ27576.1| hypothetical protein SELMODRAFT_441343 [Selaginella moellendorffii] Length = 769 Score = 33.9 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 32/75 (42%), Positives = 36/75 (48%), Gaps = 18/75 (24%) Query: 5 NAPRRNTSGREKTGTVAPP----NGSRVTAHLHTLTSEEANHGLCGPCSIARPVVSAVES 60 N P NT RE+T TV PP NGSRV AH L +E HG PV AV+S Sbjct: 515 NGPSENT--RERTETVTPPKPSSNGSRVQAHSKHLDNE---HG-----DAKGPVEEAVKS 564 Query: 61 VS----EGILRGNGL 71 S E + R GL Sbjct: 565 ESSDGEEAMQRNVGL 579 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.314 0.129 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,229,294,211 Number of extensions: 43748654 Number of successful extensions: 87975 Number of sequences better than 10.0: 9 Number of HSP's gapped: 88741 Number of HSP's successfully gapped: 9 Length of query: 124 Length of database: 5,058,227,080 Length adjustment: 90 Effective length of query: 34 Effective length of database: 3,728,231,200 Effective search space: 126759860800 Effective search space used: 126759860800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 76 (33.9 bits)