BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_1648_orf5 (142 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|302553522|ref|ZP_07305864.1| conserved hypothetical protein [... 36 1.7 gi|297204659|ref|ZP_06922056.1| conserved hypothetical protein [... 35 2.8 >gi|302553522|ref|ZP_07305864.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] gi|302471140|gb|EFL34233.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 251 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 2/99 (2%) Query: 30 LLCSSWGSPQLWRPHARLYGFLDHQHRPTLKTEHSDYHEERVWGPLLTPASPPQKKIPDS 89 +LC S G Q H L + HR T+ T+ GP TP SP + PD+ Sbjct: 150 VLCVSEGVYQGVVRHGPLGVRPEEFHRVTVGTKEGPTVAWVHGGPGSTPGSPEAR--PDA 207 Query: 90 DGTSPPSEQRWRLRLQACGFKNIGSTGWGCKCLAAKRPG 128 G P+ QR +R+ + +G T +G + RPG Sbjct: 208 SGPDLPAPQRNDVRISGDQYGQVGGTHYGDQRFDFTRPG 246 >gi|297204659|ref|ZP_06922056.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|197710725|gb|EDY54759.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 134 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 31/89 (34%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Query: 52 DH-QHRPTLKTEHSDYHEERVWGPLLTPASPPQKKIPDSDGTSPPSEQRWRLRLQACGFK 110 DH Q RP + T E R W P PA+ + PD D +P R R +L A F+ Sbjct: 7 DHGQDRPVIGTLEEGDDEGRSWSPYENPAA---ELSPDLDDFAPVRIPRLRRKLTAIPFQ 63 Query: 111 NIGSTGWG-CKCLAAKRPGRERAAMECGR 138 + S +G K A +RPG A GR Sbjct: 64 PLRSHSFGEEKHPAGRRPGAADTARTPGR 92 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.320 0.135 0.465 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,697,467,743 Number of extensions: 72466991 Number of successful extensions: 147941 Number of sequences better than 10.0: 15 Number of HSP's gapped: 149116 Number of HSP's successfully gapped: 15 Length of query: 142 Length of database: 5,058,227,080 Length adjustment: 106 Effective length of query: 36 Effective length of database: 3,491,787,488 Effective search space: 125704349568 Effective search space used: 125704349568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.9 bits)