BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_1648_orf2 (113 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|340052501|emb|CCC46781.1| conserved hypothetical protein [Try... 34 8.8 >gi|340052501|emb|CCC46781.1| conserved hypothetical protein [Trypanosoma vivax Y486] Length = 669 Score = 33.9 bits (76), Expect = 8.8, Method: Compositional matrix adjust. Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 7/85 (8%) Query: 25 PVASSRSSRLRIPLFGFVQGDTKWSSCTVLDTSSLSGVCHFVGVNIFFPCLI--PHAVIA 82 P + + R+P G V G W+ C S+ G + F P ++ P+A+ + Sbjct: 114 PCGTDVDANCRVPFSGLVHGGASWTDCGATRGGSMYG-----DMEAFLPPIVGHPNAMSS 168 Query: 83 FETARRSCTNSVRCKPASFWCVAPN 107 F A S S+ P C AP Sbjct: 169 FGCAEFSDFGSMYLTPMENMCCAPG 193 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.324 0.135 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,149,156,795 Number of extensions: 39990078 Number of successful extensions: 104858 Number of sequences better than 10.0: 1 Number of HSP's gapped: 105329 Number of HSP's successfully gapped: 1 Length of query: 113 Length of database: 5,058,227,080 Length adjustment: 81 Effective length of query: 32 Effective length of database: 3,861,230,788 Effective search space: 123559385216 Effective search space used: 123559385216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 76 (33.9 bits)