BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_1585_orf6
         (73 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|147766511|emb|CAN67681.1| hypothetical protein VITISV_019495 ...    34     8.6  

>gi|147766511|emb|CAN67681.1| hypothetical protein VITISV_019495 [Vitis vinifera]
          Length = 465

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 11 KMCFKSKVDRLNGGAASVRQPDEG---RSPLVHPHALGPSYTDRLHSSKIKIKINQSDEK 67
          +M    +V  L+G    VR P  G   R P+V+P AL  SY D+L       K +Q  EK
Sbjct: 8  QMAAHIRVQLLSGYV--VRTPSNGVSGRPPMVYPDALSGSYLDKLKQGFSYTKASQQKEK 65

Query: 68 GEE 70
           +E
Sbjct: 66 SKE 68


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.310    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 679,227,869
Number of extensions: 21468731
Number of successful extensions: 33353
Number of sequences better than 10.0: 1
Number of HSP's gapped: 33533
Number of HSP's successfully gapped: 1
Length of query: 73
Length of database: 5,058,227,080
Length adjustment: 44
Effective length of query: 29
Effective length of database: 4,408,006,872
Effective search space: 127832199288
Effective search space used: 127832199288
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 76 (33.9 bits)