BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_1292_orf1 (157 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|221507979|gb|EEE33566.1| conserved hypothetical protein [Toxo... 42 0.022 gi|237845003|ref|XP_002371799.1| hypothetical protein, conserved... 42 0.022 gi|221483509|gb|EEE21828.1| conserved hypothetical protein [Toxo... 42 0.023 gi|325118954|emb|CBZ54506.1| conserved hypothetical protein [Neo... 42 0.037 gi|114330589|ref|YP_746811.1| ribosomal protein L18 [Nitrosomona... 39 0.20 gi|30248434|ref|NP_840504.1| ribosomal protein L18P/L5E:ribosoma... 39 0.29 gi|296120763|ref|YP_003628541.1| ribosomal protein L18 [Planctom... 37 0.74 gi|189218711|ref|YP_001939352.1| ribosomal protein L18 [Methylac... 37 1.2 gi|115376099|ref|ZP_01463344.1| ribosomal protein L18 [Stigmatel... 36 2.0 gi|33862099|ref|NP_893660.1| 50S ribosomal protein L18 [Prochlor... 34 5.7 >gi|221507979|gb|EEE33566.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 219 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 25/33 (75%) Query: 125 RRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 +R RLT TLSNN ++AC+ D Q+T+A+A+S Sbjct: 147 KRARLTITLSNNQVHACVVDNRLQRTYAYANSF 179 >gi|237845003|ref|XP_002371799.1| hypothetical protein, conserved [Toxoplasma gondii ME49] gi|211969463|gb|EEB04659.1| hypothetical protein, conserved [Toxoplasma gondii ME49] Length = 219 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 25/33 (75%) Query: 125 RRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 +R RLT TLSNN ++AC+ D Q+T+A+A+S Sbjct: 147 KRARLTITLSNNQVHACVVDNRLQRTYAYANSF 179 >gi|221483509|gb|EEE21828.1| conserved hypothetical protein [Toxoplasma gondii GT1] Length = 219 Score = 42.4 bits (98), Expect = 0.023, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 25/33 (75%) Query: 125 RRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 +R RLT TLSNN ++AC+ D Q+T+A+A+S Sbjct: 147 KRARLTITLSNNQVHACVVDNRLQRTYAYANSF 179 >gi|325118954|emb|CBZ54506.1| conserved hypothetical protein [Neospora caninum Liverpool] Length = 473 Score = 41.6 bits (96), Expect = 0.037, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 25/33 (75%) Query: 125 RRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 +R RLT TLSNN ++AC+ D Q+T+A+A+S Sbjct: 404 KRARLTITLSNNQVHACVVDNRLQRTYAYANSF 436 >gi|114330589|ref|YP_746811.1| ribosomal protein L18 [Nitrosomonas eutropha C91] gi|114307603|gb|ABI58846.1| LSU ribosomal protein L18P [Nitrosomonas eutropha C91] Length = 120 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 22/36 (61%) Query: 122 SSSRRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 S+S+R RL SNNHIYA I DPS AS++ Sbjct: 22 SNSKRFRLLVHKSNNHIYAQILDPSSNNVVVSASTV 57 >gi|30248434|ref|NP_840504.1| ribosomal protein L18P/L5E:ribosomal protein L18 [Nitrosomonas europaea ATCC 19718] gi|73621631|sp|Q820Q8.1|RL18_NITEU RecName: Full=50S ribosomal protein L18 gi|30138320|emb|CAD84328.1| Ribosomal protein L18P/L5E:Ribosomal protein L18 [Nitrosomonas europaea ATCC 19718] Length = 119 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 23/35 (65%) Query: 123 SSRRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 +SR+ RL+ SNNHIYA I DPS + AS++ Sbjct: 22 NSRQFRLSVHKSNNHIYAQILDPSSNRVIVSASTV 56 >gi|296120763|ref|YP_003628541.1| ribosomal protein L18 [Planctomyces limnophilus DSM 3776] gi|296013103|gb|ADG66342.1| ribosomal protein L18 [Planctomyces limnophilus DSM 3776] Length = 120 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 19/35 (54%), Positives = 21/35 (60%) Query: 123 SSRRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 SS RLRLT SN HIYA I D QT AS++ Sbjct: 24 SSGRLRLTVFRSNKHIYAQIVDDVAGQTLVSASTV 58 >gi|189218711|ref|YP_001939352.1| ribosomal protein L18 [Methylacidiphilum infernorum V4] gi|189185569|gb|ACD82754.1| Ribosomal protein L18 [Methylacidiphilum infernorum V4] Length = 125 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 20/30 (66%) Query: 128 RLTATLSNNHIYACITDPSGQQTFAFASSM 157 RL+ SNNHIYA + + +T AFAS+M Sbjct: 36 RLSVYFSNNHIYAQLINDEEGRTLAFASTM 65 >gi|115376099|ref|ZP_01463344.1| ribosomal protein L18 [Stigmatella aurantiaca DW4/3-1] gi|310821010|ref|YP_003953368.1| 50S ribosomal protein L18 [Stigmatella aurantiaca DW4/3-1] gi|115366914|gb|EAU65904.1| ribosomal protein L18 [Stigmatella aurantiaca DW4/3-1] gi|309394082|gb|ADO71541.1| 50S ribosomal protein L18 [Stigmatella aurantiaca DW4/3-1] Length = 117 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 22/35 (62%) Query: 123 SSRRLRLTATLSNNHIYACITDPSGQQTFAFASSM 157 SS R RLT S HIYA + D S +T A+ASS+ Sbjct: 21 SSERPRLTVYKSLKHIYAQVVDDSTGKTLAYASSL 55 >gi|33862099|ref|NP_893660.1| 50S ribosomal protein L18 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] gi|73621672|sp|Q7UZV9.1|RL18_PROMP RecName: Full=50S ribosomal protein L18 gi|33634317|emb|CAE20002.1| 50S ribosomal protein L18 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] Length = 122 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 18/30 (60%) Query: 128 RLTATLSNNHIYACITDPSGQQTFAFASSM 157 RL SNNHIYA + D QQT AS++ Sbjct: 29 RLAVFRSNNHIYAQVIDDDAQQTICSASTV 58 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.319 0.128 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 995,205,519 Number of extensions: 19320895 Number of successful extensions: 28709 Number of sequences better than 10.0: 13 Number of HSP's gapped: 28746 Number of HSP's successfully gapped: 13 Length of query: 157 Length of database: 5,058,227,080 Length adjustment: 119 Effective length of query: 38 Effective length of database: 3,299,676,972 Effective search space: 125387724936 Effective search space used: 125387724936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 76 (33.9 bits)