BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_1256_orf2
         (51 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|84995979|ref|XP_952711.1| hypothetical protein [Theileria ann...    33     9.8  

>gi|84995979|ref|XP_952711.1| hypothetical protein [Theileria annulata strain Ankara]
 gi|65303708|emb|CAI76085.1| hypothetical telomeric protein, conserved [Theileria annulata]
          Length = 605

 Score = 33.5 bits (75), Expect = 9.8,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 22/31 (70%)

Query: 19  TTTKPNELCMHIDVSVLCLNINTYSHVYEYM 49
           + TKP  +CMH+D++ + +  + Y ++Y+Y+
Sbjct: 89  SETKPRAICMHMDINEIVMQFDGYLNIYKYI 119


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.328    0.135    0.474 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 493,627,727
Number of extensions: 12612256
Number of successful extensions: 27338
Number of sequences better than 10.0: 1
Number of HSP's gapped: 27397
Number of HSP's successfully gapped: 1
Length of query: 51
Length of database: 5,058,227,080
Length adjustment: 24
Effective length of query: 27
Effective length of database: 4,703,561,512
Effective search space: 126996160824
Effective search space used: 126996160824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 76 (33.9 bits)