BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_0672_orf2
         (74 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|323448831|gb|EGB04725.1| expressed protein [Aureococcus anoph...    34     6.5  

>gi|323448831|gb|EGB04725.1| expressed protein [Aureococcus anophagefferens]
          Length = 397

 Score = 34.3 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 32/47 (68%), Gaps = 2/47 (4%)

Query: 28  EDAKAEKENGSRIRSERTQQQRQQPEIDRDAKRSEEAEPDSGCGNEI 74
           E+ K +++ G+ IR+ER Q++ +Q  +   A+RS++ +PD G G E+
Sbjct: 353 EEDKYDQQMGTNIRAERHQKKEKQKRVV--ARRSDKVKPDIGEGGEL 397


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.310    0.130    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 757,523,680
Number of extensions: 24232180
Number of successful extensions: 152259
Number of sequences better than 10.0: 51
Number of HSP's gapped: 155042
Number of HSP's successfully gapped: 51
Length of query: 74
Length of database: 5,058,227,080
Length adjustment: 45
Effective length of query: 29
Effective length of database: 4,393,229,140
Effective search space: 127403645060
Effective search space used: 127403645060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 76 (33.9 bits)