BLASTP 2.2.24 [Aug-08-2010] 

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Eten_0672_orf14
         (63 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           14,777,732 sequences; 5,058,227,080 total letters

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|117921081|ref|YP_870273.1| hypothetical protein Shewana3_2640...    35     2.5  

>gi|117921081|ref|YP_870273.1| hypothetical protein Shewana3_2640 [Shewanella sp. ANA-3]
 gi|117613413|gb|ABK48867.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 782

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 2   SSFVLFHLFMKFANKHVLFFTLLLLFKGRIFSFLIRYSLSRAY-LHETVFRGS 53
           +S +LF LF+  AN H    +L+LLF+  +FSF++ + L + Y   +TVF+ +
Sbjct: 65  ASLILFSLFVALANPHYFTASLVLLFE-YLFSFVVLFLLHKEYQFIKTVFKAT 116


  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF excluding environmental samples
  from WGS projects
    Posted date:  Jul 22, 2011  4:42 PM
  Number of letters in database: 5,058,227,080
  Number of sequences in database:  14,777,732
  
Lambda     K      H
   0.340    0.149    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 14777732
Number of Hits to DB: 510,690,144
Number of extensions: 14338801
Number of successful extensions: 49174
Number of sequences better than 10.0: 1
Number of HSP's gapped: 49315
Number of HSP's successfully gapped: 1
Length of query: 63
Length of database: 5,058,227,080
Length adjustment: 35
Effective length of query: 28
Effective length of database: 4,541,006,460
Effective search space: 127148180880
Effective search space used: 127148180880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.9 bits)
S2: 76 (33.9 bits)