BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_0662_orf2 (113 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|167535605|ref|XP_001749476.1| hypothetical protein [Monosiga ... 38 0.40 gi|312198093|ref|YP_004018154.1| hypothetical protein FraEuI1c_4... 33 9.9 >gi|167535605|ref|XP_001749476.1| hypothetical protein [Monosiga brevicollis MX1] gi|163772104|gb|EDQ85761.1| predicted protein [Monosiga brevicollis MX1] Length = 1194 Score = 38.1 bits (87), Expect = 0.40, Method: Compositional matrix adjust. Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 7/60 (11%) Query: 34 MHQLSSHVRPPQWQVLCLTTNYGSILKNFRGPLQGP---SSPAAHGNMDSEAEWTAVPPD 90 +HQ SS +PP LC+ NYG ++ R PL+ P PA ++D A W +V PD Sbjct: 417 LHQRSSRSKPPS---LCINVNYG-LMNWTRSPLRSPFVHHVPALQWSVDDVANWISVLPD 472 >gi|312198093|ref|YP_004018154.1| hypothetical protein FraEuI1c_4285 [Frankia sp. EuI1c] gi|311229429|gb|ADP82284.1| hypothetical protein FraEuI1c_4285 [Frankia sp. EuI1c] Length = 536 Score = 33.5 bits (75), Expect = 9.9, Method: Compositional matrix adjust. Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Query: 1 PLLSCLHAGARICSNPDEGARLGYANVHHTAAEMHQLSSHVRPPQWQVLCLTTNYGSILK 60 P+L +AG + N D G +G+ ++ T A Q++ V P + + L NYG Sbjct: 388 PVLPASNAGPIVAMNADVGETIGWPDLVRTVA---QVARQVPPGRGTPVILARNYGEAGA 444 Query: 61 NFR-GPLQGPSSPAAHGNMDSEAEWTAVPPDR 91 R GP G PAA+ ++ +W PPDR Sbjct: 445 VDRYGPALG--LPAAYSGHNAFGDWGP-PPDR 473 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.314 0.130 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,296,029,185 Number of extensions: 50371107 Number of successful extensions: 77065 Number of sequences better than 10.0: 7 Number of HSP's gapped: 77665 Number of HSP's successfully gapped: 7 Length of query: 113 Length of database: 5,058,227,080 Length adjustment: 81 Effective length of query: 32 Effective length of database: 3,861,230,788 Effective search space: 123559385216 Effective search space used: 123559385216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 76 (33.9 bits)